[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00035.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:Y1227_LACS1  RecName: Full=UPF0133 protein LSL_1227;

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  12->104 1pugA_ d.222.1.1 * 1.1e-26 43.8 %
:HMM:PFM   12->101 PF02575 * DUF149 3.2e-31 35.6 90/93  
:BLT:SWISS 27->104 Y1227_LACS1 7e-30 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00035.1 GT:GENE ABE00035.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1260213..1260527) GB:FROM 1260213 GB:TO 1260527 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABE00035.1 GB:DB_XREF GI:90821396 LENGTH 104 SQ:AASEQ MMMRGMNMQSMMKQMQKLQKNMKKDQDELNATVFEGHAADDAVVVKFTGDHKMTDISIKEEAIDPDDVDMLQDLVLMAVNDAMSKIDKQTQETMGKYSRNIPGL GT:EXON 1|1-104:0| SW:ID Y1227_LACS1 SW:DE RecName: Full=UPF0133 protein LSL_1227; SW:GN OrderedLocusNames=LSL_1227; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 27->104|Y1227_LACS1|7e-30|100.0|78/104| SEG 1->26|mmmrgmnmqsmmkqmqklqknmkkdq| SEG 64->79|dpddvdmlqdlvlmav| HM:PFM:NREP 1 HM:PFM:REP 12->101|PF02575|3.2e-31|35.6|90/93|DUF149| HM:SCP:REP 12->104|1pugA_|1.1e-26|43.8|89/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------1---11---1-11--11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-27| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccEEEEEEEcccEEEEEEEcHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //