[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00049.1
DDBJ      :             Protein translocase subunit secE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   7->54 3dinD PDBj 2e-06 22.9 %
:HMM:PFM   2->55 PF00584 * SecE 8.6e-15 31.5 54/57  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00049.1 GT:GENE ABE00049.1 GT:PRODUCT Protein translocase subunit secE GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1274077..1274244) GB:FROM 1274077 GB:TO 1274244 GB:DIRECTION - GB:PRODUCT Protein translocase subunit secE GB:PROTEIN_ID ABE00049.1 GB:DB_XREF GI:90821410 LENGTH 55 SQ:AASEQ MKFLKNVIKTMKDTTWLNAKETRRDTTTVIISSLLFIGFFAVVDWVIQSALSLLV GT:EXON 1|1-55:0| TM:NTM 1 TM:REGION 29->51| RP:PDB:NREP 1 RP:PDB:REP 7->54|3dinD|2e-06|22.9|48/56| HM:PFM:NREP 1 HM:PFM:REP 2->55|PF00584|8.6e-15|31.5|54/57|SecE| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------1111---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 96.4 SQ:SECSTR #HHHHHHHHHHHHHHHHHcccccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHH# PSIPRED cHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //