[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00053.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  209/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
a.149.1
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->132 1u61A PDBj 3e-26 47.6 %
:RPS:PDB   5->133 2eb1C PDBj 2e-22 20.3 %
:RPS:SCOP  6->132 1u61A  a.149.1.1 * 7e-52 50.4 %
:HMM:SCOP  6->132 1u61A_ a.149.1.1 * 3.2e-43 47.2 %
:HMM:PFM   16->114 PF00636 * Ribonuclease_3 7.7e-13 20.2 99/105  
:BLT:SWISS 1->122 YAT4_SYNP1 3e-14 38.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00053.1 GT:GENE ABE00053.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1275759..1276166) GB:FROM 1275759 GB:TO 1276166 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABE00053.1 GB:DB_XREF GI:90821414 LENGTH 135 SQ:AASEQ MIKEDVDYNQMNGIALAYMGDAIYEIYIRRHLLAKGLTKPTKLHHKATHYVSAKAQAFLIEKMQEQNVLNDEELEFFKRGRNAKSHTSAKNTSVVTYRISTGFEALFGYLYLSDQIERLEELADWCINTVEKEGK GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 1->122|YAT4_SYNP1|3e-14|38.6|114/100| BL:PDB:NREP 1 BL:PDB:REP 6->132|1u61A|3e-26|47.6|126/126| RP:PDB:NREP 1 RP:PDB:REP 5->133|2eb1C|2e-22|20.3|128/169| HM:PFM:NREP 1 HM:PFM:REP 16->114|PF00636|7.7e-13|20.2|99/105|Ribonuclease_3| RP:SCP:NREP 1 RP:SCP:REP 6->132|1u61A|7e-52|50.4|127/127|a.149.1.1| HM:SCP:REP 6->132|1u61A_|3.2e-43|47.2|127/127|a.149.1.1|1/1|RNase III domain-like| OP:NHOMO 227 OP:NHOMOORG 221 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------11-111-----11-1-11-1-1111-111---1-1-1--------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111-11111111111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1111111111--- ------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------1-122-12122--11------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 96.3 SQ:SECSTR ####TTccccccTHHHHHHHHHHHHHHHHHHHHHcTcccHHHHHHHHHHHccHHHHHHHHHHTTGGGTcccccHHHHHHHHHHHHHHHTcccccccHHHHHHHHHHHHHHHHTHTTccHHHHHHHHHHHHHHHT# DISOP:02AL 1-4,133-136| PSIPRED cccccccHHHHcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //