[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00081.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:288 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->147 PF01925 * TauE 1.7e-13 19.0 137/239  
:HMM:PFM   174->286 PF01925 * TauE 6.3e-09 27.3 110/239  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00081.1 GT:GENE ABE00081.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1311074..1311940) GB:FROM 1311074 GB:TO 1311940 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABE00081.1 GB:DB_XREF GI:90821442 LENGTH 288 SQ:AASEQ MVRYILLTMVVIVNGYFATVFIRDLLKHKQEFKEEPADSKWLALSSFIIFFLSTFGISDFAIGTVLYQKAKWVSMKKLPGTLNTECVIPVAVMALSYITGISVGIKTLLVCIICQVIGAYLGPRFVVKLPEKTIKVFVGIGLIIASLLIVAGQLKLIPSNGTATELYGWKLILAGFLLFVYGALNNIGIGSYALTMVTVYLLGLNPIAAFPIMMGACTFSVPVGSVQFIKLDDYSRKITLFTATFGVLGVLVAVFLVKQLNTYLLNWLVVIVLLYSAYTMLSKQKEEA GT:EXON 1|1-288:0| TM:NTM 7 TM:REGION 4->26| TM:REGION 44->66| TM:REGION 91->113| TM:REGION 134->156| TM:REGION 165->187| TM:REGION 199->221| TM:REGION 248->270| SEG 42->58|lalssfiifflstfgis| SEG 245->257|fgvlgvlvavflv| HM:PFM:NREP 2 HM:PFM:REP 9->147|PF01925|1.7e-13|19.0|137/239|TauE| HM:PFM:REP 174->286|PF01925|6.3e-09|27.3|110/239|TauE| OP:NHOMO 75 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11-----11-----1-11-------1----11-----------111111-1-1111-11---1111-11--4444444-4--1---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------1111-----------------------------------------------------------1111------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 286-289| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHc //