[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00103.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:347 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   76->104 PF05793 * TFIIF_alpha 0.00037 37.9 29/529  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00103.1 GT:GENE ABE00103.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1341804..1342847) GB:FROM 1341804 GB:TO 1342847 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABE00103.1 GB:DB_XREF GI:90821464 LENGTH 347 SQ:AASEQ MIVGAYDLDLKKMKKQIVIIKKNGKVRVKRYSYRLEINGDRKFFDRTFKFDEEITQKILASIRDCFNNREGNIIGLDARPWTLDVTDENGRKNQLVGIVNGDKSVSKISSYIREELDLDYLWLFDGKDIRDEIKKVILETRHNLSDTIKIEKLIITAKEDKIEYSQKDDKGMKSAKTYVIPNKVKELLENYSFTNSFNRILGNPKDVIEPEEKRDYQLIIENSQNDRKIYVGTYDKYSLPTDWGDFIKDITNIISQEGETEIFKSSVYNRRLRRKGEYIICGVFFEGGYKEYNYLTDDESIQVGDEVEIPVGVDNRVVKAKIADVNYYYKEKAPYPIEKTKKILRKV GT:EXON 1|1-347:0| SEG 11->22|kkmkkqiviikk| SEG 40->51|drkffdrtfkfd| HM:PFM:NREP 1 HM:PFM:REP 76->104|PF05793|0.00037|37.9|29/529|TFIIF_alpha| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,163-172| PSIPRED cEEEEEcccHHHHHEEEEEEEcccEEEEEEEEEEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEcccccEEEEEEEEEcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccHHcccHHcccccccEEEccHHHHHHHHcccccHHHHHHHccHHHHccHHccccEEEEEEccccccEEEEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccEEEccEEEEcccccccEEEEEEEccEEEEcccccccHHHHHHHHHcc //