[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00107.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->62 PF07225 * NDUF_B4 0.00036 32.6 43/125  
:BLT:SWISS 11->104 AROD_METM7 8e-05 31.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00107.1 GT:GENE ABE00107.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1346571..1346885) GB:FROM 1346571 GB:TO 1346885 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABE00107.1 GB:DB_XREF GI:90821468 LENGTH 104 SQ:AASEQ MAKKSNETLTLIEEITRNDGSKYYEISNMVQNGRAELAAIRGMIKEVRIIQLNIPHSTNVIKYENYVNENFEMPPENFTEFEEWKKTPEMEEIVEKILKENHIG GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 11->104|AROD_METM7|8e-05|31.5|89/218| HM:PFM:NREP 1 HM:PFM:REP 19->62|PF07225|0.00036|32.6|43/125|NDUF_B4| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,104-105| PSIPRED ccccccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHccEEEEEEEEEEcccHHHHHHHHHHHcccccccccccccHHHHcccHHHHHHHHHHHHHcccc //