[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00121.1
DDBJ      :             Malolactic regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  524/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->249 3hhgG PDBj 1e-08 24.9 %
:RPS:PDB   1->216 1bi3A PDBj 7e-17 10.8 %
:RPS:SCOP  1->103 1b9mA1  a.4.5.8 * 5e-14 12.9 %
:RPS:SCOP  92->289 1i69A  c.94.1.1 * 2e-18 21.3 %
:HMM:SCOP  1->91 1ixcA1 a.4.5.37 * 2.3e-14 27.0 %
:HMM:SCOP  86->292 2fyiA1 c.94.1.1 * 4.5e-21 26.2 %
:RPS:PFM   92->291 PF03466 * LysR_substrate 1e-11 25.5 %
:HMM:PFM   88->291 PF03466 * LysR_substrate 2e-27 24.5 200/209  
:HMM:PFM   4->64 PF00126 * HTH_1 3.5e-13 33.9 59/60  
:BLT:SWISS 1->293 MLER_LACLA 1e-31 29.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00121.1 GT:GENE ABE00121.1 GT:PRODUCT Malolactic regulator, LysR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1361886..1362767 GB:FROM 1361886 GB:TO 1362767 GB:DIRECTION + GB:PRODUCT Malolactic regulator, LysR family GB:NOTE COG0583 [K] Transcriptional regulator GB:PROTEIN_ID ABE00121.1 GB:DB_XREF GI:90821482 LENGTH 293 SQ:AASEQ MDTKSLEYYHKLVEEKIFSKVAEFFEVSQPTITLAIKRLENEYQTKFFLRDRSHKELILTKDGKQFDRHVVTILNELEIARKEISRNQEQMIRLGLPPIISQFYFPQITPGLTDNKLLRRIEPYEEKGSAILLKMLKDGTLDMSLLSSTTPLTDKNLKAHIISKANFKIIVSPQHRLANRKSVTFNELVNENFINLNSSFIHAEVFKHFAHEAHFRPTIIFQTSDVPLLKSLVSQNTGIALLTDLALKNTDDLVALDIETNIPLNFIVSIAYRRSHILTPNQSKLISLLTDKK GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 1->293|MLER_LACLA|1e-31|29.2|288/291| BL:PDB:NREP 1 BL:PDB:REP 2->249|3hhgG|1e-08|24.9|229/294| RP:PDB:NREP 1 RP:PDB:REP 1->216|1bi3A|7e-17|10.8|203/211| RP:PFM:NREP 1 RP:PFM:REP 92->291|PF03466|1e-11|25.5|196/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 88->291|PF03466|2e-27|24.5|200/209|LysR_substrate| HM:PFM:REP 4->64|PF00126|3.5e-13|33.9|59/60|HTH_1| RP:SCP:NREP 2 RP:SCP:REP 1->103|1b9mA1|5e-14|12.9|101/122|a.4.5.8| RP:SCP:REP 92->289|1i69A|2e-18|21.3|188/206|c.94.1.1| HM:SCP:REP 1->91|1ixcA1|2.3e-14|27.0|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 86->292|2fyiA1|4.5e-21|26.2|202/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1310 OP:NHOMOORG 527 OP:PATTERN -------------------------------------------------------------------- 122-1--111----211--------1----------2452-------1------1-----------212-1--------1-1---1--11----------13-1-111-3--------------------------122-----111------------------------1--------------------376666676726556662254698671325121222222AJ-1111111111111112225112-22-12-1773332122212211111111111------------1111111-111111--------3--1631111121212-75511121---1-12--77-31-1-2-1111--2-11-----------124---211-211211122122-------12-1--4---12131231131--1-11-11--1111111111--1-----------------------------------11--165426447762444444834444317762343--3211111131522212111112111111-1--11122-------1-121--1-1212--------1-1--2----------------------114211114111421111-14222131311221---112------62331545445545444-4455544445444445445555242435363556665756533454443442-221222212222--1-111112322--2122221211332312213333314-112111213337-5655-33421111111132333444442223311212111111111------------------1-------------------------------------22- --------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------8-----------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 291 STR:RPRED 99.3 SQ:SECSTR HHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTHTccTcEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHTTTccHHHHHHHHHHcccccccTTEcccccTTHHHHTcccEEHHHHcccTTccEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEccccEEEETTEEEEccHEEEEEHHHHHcEEETTcEEEEEEHHHHHHHHHHTccEEEEEGGGccTcTTcEEEEcccTTcccEEEEEEEETTccccHHHHHHHHHHcT## DISOP:02AL 84-85,293-294| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHcccccEEEEccccccccccEEEEEEEEccEEEEEcccccccccccccHHHHccccEEEEccccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHccccEEEEEHHHccccccEEEEEccccccEEEEEEEEEcccccccHHHHHHHHHHHHcc //