[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00125.1
DDBJ      :             CopAB ATPases metal-fist type repressor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  133/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->122 1sd6A PDBj 2e-17 37.7 %
:RPS:PDB   1->68 2co5B PDBj 5e-07 11.8 %
:RPS:SCOP  3->86 2g9wA1  a.4.5.39 * 5e-09 25.0 %
:HMM:SCOP  4->125 1sd4A_ a.4.5.39 * 1.5e-28 26.2 %
:RPS:PFM   11->120 PF03965 * Pencillinase_R 9e-18 32.7 %
:HMM:PFM   7->120 PF03965 * Pencillinase_R 1.5e-36 30.7 114/115  
:BLT:SWISS 5->142 COPY_ENTHR 8e-30 39.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00125.1 GT:GENE ABE00125.1 GT:PRODUCT CopAB ATPases metal-fist type repressor GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1364738..1365184) GB:FROM 1364738 GB:TO 1365184 GB:DIRECTION - GB:PRODUCT CopAB ATPases metal-fist type repressor GB:NOTE COG1395 [K] Predicted transcriptional regulator GB:PROTEIN_ID ABE00125.1 GB:DB_XREF GI:90821486 LENGTH 148 SQ:AASEQ MLEKVEISNAEWDVMRVIWALGETTSRQIIEALSDRRQWKPATTKTLIGRLVAKGYVGTRRKGRAYIYYPIIKEQQTINEQILTSFGNICQMHVGQTLATVLNNVELSKDDIKKLESILEVKAKNAPESLPCNCVPNGSCDCMMEMDN GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 5->142|COPY_ENTHR|8e-30|39.3|135/145| BL:PDB:NREP 1 BL:PDB:REP 6->122|1sd6A|2e-17|37.7|114/119| RP:PDB:NREP 1 RP:PDB:REP 1->68|2co5B|5e-07|11.8|68/94| RP:PFM:NREP 1 RP:PFM:REP 11->120|PF03965|9e-18|32.7|110/115|Pencillinase_R| HM:PFM:NREP 1 HM:PFM:REP 7->120|PF03965|1.5e-36|30.7|114/115|Pencillinase_R| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF03965|IPR005650| GO:PFM GO:0016481|"GO:negative regulation of transcription"|PF03965|IPR005650| GO:PFM GO:0016566|"GO:specific transcriptional repressor activity"|PF03965|IPR005650| RP:SCP:NREP 1 RP:SCP:REP 3->86|2g9wA1|5e-09|25.0|84/119|a.4.5.39| HM:SCP:REP 4->125|1sd4A_|1.5e-28|26.2|122/0|a.4.5.39|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 152 OP:NHOMOORG 133 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------11111112-1--1--1-11---1--------------41111-1-----111----1--111121111111111111112111112111111311111111111111111-111111112111111111---13---11112-1-133------11------113----1----111-1----11----------------------------------------------------------1---------------------------------------------------------1--1--------------------------------------------------------------------------------------------------------------------------------------1-------1-----1-----1-11--1---------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1-1--111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 82.4 SQ:SECSTR ccTTccHHHHHHHHHHHHTTTEEEGGGHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTccEEEEcccHHHHHHHHHHHHHHHHcTTHHHHHHHHHHTTTcccHHHHHHHHHHHHcc########################## DISOP:02AL 1-5,121-128,143-149| PSIPRED ccccccccHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcc //