[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00133.1
DDBJ      :             Hypothetical secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:HMM:PFM   49->63 PF04304 * DUF454 0.00066 33.3 15/71  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00133.1 GT:GENE ABE00133.1 GT:PRODUCT Hypothetical secreted protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1377774..1378067 GB:FROM 1377774 GB:TO 1378067 GB:DIRECTION + GB:PRODUCT Hypothetical secreted protein GB:PROTEIN_ID ABE00133.1 GB:DB_XREF GI:90821494 LENGTH 97 SQ:AASEQ MRFVLRGIWLVLAIFFFVLGLVGLALPVIPQVPFFLLAIYFTSKFSPKFHNWILNNRLYKKYLLPLKNVIRNEREVVKDKSKQVWYKVLMAKLGFIR GT:EXON 1|1-97:0| TM:NTM 1 TM:REGION 13->35| SEG 10->30|lvlaifffvlglvglalpvip| HM:PFM:NREP 1 HM:PFM:REP 49->63|PF04304|0.00066|33.3|15/71|DUF454| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //