[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00138.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  125/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.140.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->180 1v8dC PDBj 5e-31 42.4 %
:RPS:SCOP  3->172 1v8dA  c.140.1.1 * 6e-04 33.9 %
:HMM:SCOP  3->187 1v8dA_ c.140.1.1 * 1.9e-70 53.0 %
:RPS:PFM   8->179 PF04260 * DUF436 3e-56 62.2 %
:HMM:PFM   9->179 PF04260 * DUF436 3.4e-82 59.1 171/172  
:BLT:SWISS 1->182 Y314_STRSY 5e-60 60.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00138.1 GT:GENE ABE00138.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1383272..1383829 GB:FROM 1383272 GB:TO 1383829 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABE00138.1 GB:DB_XREF GI:90821499 LENGTH 185 SQ:AASEQ MELTEIKEKTLQALNESLEQANLKKDDIFVLGMSTSEIQGQHIGKHSNIDIGRTVVNTINDRLKEIGVHLAVQGCEHLNRALIVEESVAEKNNLEIVTVYPSLHAGGAGQIAAFEAFDNPVEVEHITAKAGMDIGDTSIGMHVKFVQIPVRTSVTEIGKAHVTFLRSRPKLIGGQRAKYTWDPFN GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 1->182|Y314_STRSY|5e-60|60.4|182/188| BL:PDB:NREP 1 BL:PDB:REP 6->180|1v8dC|5e-31|42.4|172/188| RP:PFM:NREP 1 RP:PFM:REP 8->179|PF04260|3e-56|62.2|172/172|DUF436| HM:PFM:NREP 1 HM:PFM:REP 9->179|PF04260|3.4e-82|59.1|171/172|DUF436| RP:SCP:NREP 1 RP:SCP:REP 3->172|1v8dA|6e-04|33.9|165/189|c.140.1.1| HM:SCP:REP 3->187|1v8dA_|1.9e-70|53.0|185/193|c.140.1.1|1/1|Hypothetical protein TT1679| OP:NHOMO 125 OP:NHOMOORG 125 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1111111111111111111111111111111111------11111111111111111111111-11--11-----11--11----11111111111111111111111111111111111111111111111-----------------------1----1--1-11-----1-1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 94.1 SQ:SECSTR #####HHHHHHHHHHHHHHHccccTTcEEEEEEcHHHHHTT#HcccccHHHHHHHHHHHHHHHHHTTcEEEEEccGGGTTcEEEEHHHHHHHTcccccccccTTcccHHHHHHHHHcccEEEEcccTTccEEEEcccccGGGccccEEEEcccccEETTEEEEEEEEcccccccTTcccc##### DISOP:02AL 1-3,180-186| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHcccccccccHHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccccEEEEEEEccccccHHHHHHHcEEEEEEEEEEHHHHHccHHHHHHHHccccccccccccccccccc //