[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00143.1
DDBJ      :             DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1g.41.9
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->67 1sq8A PDBj 4e-05 36.1 %
:RPS:PDB   1->68 1adrA PDBj 2e-13 33.8 %
:RPS:SCOP  5->95 2icpA1  a.35.1.3 * 8e-14 11.5 %
:RPS:SCOP  158->194 1i3qL  g.41.9.2 * 9e-04 13.5 %
:HMM:SCOP  1->69 2bnmA1 a.35.1.3 * 2e-15 36.2 %
:RPS:PFM   14->64 PF01381 * HTH_3 3e-06 37.3 %
:RPS:PFM   89->152 PF03866 * HAP 8e-04 33.9 %
:HMM:PFM   10->64 PF01381 * HTH_3 1.2e-14 32.7 55/55  
:HMM:PFM   58->144 PF09878 * DUF2105 0.0002 23.8 80/212  
:BLT:SWISS 1->69 DICA_ECOLI 2e-07 40.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00143.1 GT:GENE ABE00143.1 GT:PRODUCT DNA-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1388643..1389254) GB:FROM 1388643 GB:TO 1389254 GB:DIRECTION - GB:PRODUCT DNA-binding protein GB:PROTEIN_ID ABE00143.1 GB:DB_XREF GI:90821504 LENGTH 203 SQ:AASEQ MEQKKIGKFIAKRRKDLHFTQANLAKKLGITDRAVSKWENGKSIPDASLMLDLCQLLEINVNELLTGEQIVMKDYKKIAEQNLIELRNQKEKADRRLLTTVKILATLSCISAVVLILMGTLLTKISQFLGIMVVILGTILIFVTAIYAVMIEHDAGYYECPNCKMRYIPTRKAVLLASHYGTTRKMECPYCGKKGYHKKVFTK GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 1->69|DICA_ECOLI|2e-07|40.6|69/135| TM:NTM 2 TM:REGION 99->121| TM:REGION 131->153| BL:PDB:NREP 1 BL:PDB:REP 6->67|1sq8A|4e-05|36.1|61/64| RP:PDB:NREP 1 RP:PDB:REP 1->68|1adrA|2e-13|33.8|68/76| RP:PFM:NREP 2 RP:PFM:REP 14->64|PF01381|3e-06|37.3|51/55|HTH_3| RP:PFM:REP 89->152|PF03866|8e-04|33.9|62/164|HAP| HM:PFM:NREP 2 HM:PFM:REP 10->64|PF01381|1.2e-14|32.7|55/55|HTH_3| HM:PFM:REP 58->144|PF09878|0.0002|23.8|80/212|DUF2105| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 2 RP:SCP:REP 5->95|2icpA1|8e-14|11.5|87/87|a.35.1.3| RP:SCP:REP 158->194|1i3qL|9e-04|13.5|37/46|g.41.9.2| HM:SCP:REP 1->69|2bnmA1|2e-15|36.2|69/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 27 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------------------------------------1-------11-------------------1----1-1-11-------------1--2111-1------1------3-----2---11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 51.2 SQ:SECSTR cccccHHHHHHHHHHHHTccHHHHHHHHTccHHHHHHHHTTcccccHHHHHHHHHHTTccHHHHHHTcHHHHHHHTcHHHHHHHHHcccHHHHHHHHHHHHHHH################################################################################################### DISOP:02AL 1-4,203-204| PSIPRED ccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEccEEEEEEcccHHHHHHcccccccccccEEEEcccHHHHHHHHcccccccccccccccccHHHHHcc //