[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00161.1
DDBJ      :             S1-type RNA-binding domain
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  674/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->74 2k4kA PDBj 8e-19 62.0 %
:RPS:PDB   1->80 3bzcA PDBj 1e-16 46.8 %
:RPS:SCOP  3->76 1sroA  b.40.4.5 * 8e-20 52.7 %
:HMM:SCOP  3->92 1go3E1 b.40.4.5 * 1.2e-23 48.3 %
:RPS:PFM   3->73 PF00575 * S1 7e-10 54.3 %
:HMM:PFM   4->74 PF00575 * S1 1e-22 53.5 71/74  
:HMM:PFM   81->145 PF01785 * Closter_coat 0.00023 16.9 65/189  
:BLT:SWISS 1->145 YABR_BACSU 1e-33 63.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00161.1 GT:GENE ABE00161.1 GT:PRODUCT S1-type RNA-binding domain GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1420126..1420590) GB:FROM 1420126 GB:TO 1420590 GB:DIRECTION - GB:PRODUCT S1-type RNA-binding domain GB:NOTE COG1098 [J] Predicted RNA binding protein (contains ribosomal protein S1 domain) GB:PROTEIN_ID ABE00161.1 GB:DB_XREF GI:90821522 LENGTH 154 SQ:AASEQ MSIEVGAKLSGKVSGITDFGAFVDLGDKKTGLVHISEVSNTFVKDIHEVLSVGDEVTVKVLSVSDDGKIGLSIKKAVDKPQKQNNQRRNNNHEQHNNRDKVKKNHNTSFKPKHEEKKKDFDSLLAGFLKESEDRLTSLKRNTEGKRGGRGGRRS GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 1->145|YABR_BACSU|1e-33|63.0|119/128| SEG 83->98|qnnqrrnnnheqhnnr| SEG 146->153|rggrggrr| BL:PDB:NREP 1 BL:PDB:REP 4->74|2k4kA|8e-19|62.0|71/130| RP:PDB:NREP 1 RP:PDB:REP 1->80|3bzcA|1e-16|46.8|79/730| RP:PFM:NREP 1 RP:PFM:REP 3->73|PF00575|7e-10|54.3|70/74|S1| HM:PFM:NREP 2 HM:PFM:REP 4->74|PF00575|1e-22|53.5|71/74|S1| HM:PFM:REP 81->145|PF01785|0.00023|16.9|65/189|Closter_coat| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 1 RP:SCP:REP 3->76|1sroA|8e-20|52.7|74/76|b.40.4.5| HM:SCP:REP 3->92|1go3E1|1.2e-23|48.3|89/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1545 OP:NHOMOORG 698 OP:PATTERN -----------------------11--1-----1--------1------------------------- 312-1-----------------------------------1122-----11-----1-11-------1---1111----22----11-1111-1--1--1-11--11311222222222211112-11-1-1--113113311-32211211---11---1-1-1-1111111-----1----223----1345444444444444444545555445433444444445414333444444444343534444131441321144224434332-2113334333433333333333334444444444444412444222217445444555444532443344134342221-44321253-33311-12-122222----1-12111---1--1--------------1--111---1111111211122--32-1-11111112-----------1-221--------11----------1---1----122221111112222222222222332222222233333223332222222212222-121211111111132221111231121121112122212242222323222----1---------------1---1112133222233211111212111111221121-1222121111133333333333333333-333333333333333333333333323222211211122222233333333313333333333331-33222222222-133311122113323133322222221123133332222211113122-11-11111233323333322233112222222222221-11--1111--------211----1--1-----------------121-111111122 -------------------------------------------------------------------------1----------------------------------3-1----------------------------------------------------------------11112-1--14122-24121---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 53.2 SQ:SECSTR TTccTTcccccEEEEEETTEEEEEcccccEEEEETTTccccccccHHHHccTTccccccEEEEETTTEEEEcccccccccEc######################################################################## DISOP:02AL 1-1,75-124,135-155| PSIPRED cccccccEEEEEEEEEEccEEEEEEccccEEEEEEEEccccccccHHHEEccccEEEEEEEEEcccccEEEEHHHccccHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHccccccccc //