[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00169.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:212 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   7->124 3ctuA PDBj 1e-05 14.5 %
:RPS:SCOP  12->136 1pvmA4  d.37.1.1 * 7e-07 15.2 %
:HMM:SCOP  1->63 1yavA1 d.37.1.1 * 0.00016 24.2 %
:HMM:SCOP  58->126 1yavA2 d.37.1.1 * 6.5e-06 17.4 %
:HMM:PFM   9->45 PF00571 * CBS 9.3e-09 40.0 35/57  
:HMM:PFM   177->209 PF02631 * RecX 0.0004 36.0 25/122  
:BLT:SWISS 13->46 Y525_METKA 3e-04 41.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00169.1 GT:GENE ABE00169.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1431056..1431694 GB:FROM 1431056 GB:TO 1431694 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG0517 [R] FOG: CBS domain GB:PROTEIN_ID ABE00169.1 GB:DB_XREF GI:90821530 LENGTH 212 SQ:AASEQ MISKSLIQTKDELVTVQEDISLAEALDILEDSGFRCVPILDKTGKIFRGNIYKMHIYRHKSRGGDMTLPVTYLLKNATKFISINAAFFNIFFTIKDLPYITVLDENNYFFGILAHNRLLKMLSRSWNVELGSYVLTVLSAGERGDLVEMSKAITKYSEIASCISLGFRKKDNLHRTLFTLPAGIEEQKLKRIVSKLQRKGFEIEEIEDLSKI GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 13->46|Y525_METKA|3e-04|41.2|34/196| SEG 80->94|fisinaaffniffti| RP:PDB:NREP 1 RP:PDB:REP 7->124|3ctuA|1e-05|14.5|117/139| HM:PFM:NREP 2 HM:PFM:REP 9->45|PF00571|9.3e-09|40.0|35/57|CBS| HM:PFM:REP 177->209|PF02631|0.0004|36.0|25/122|RecX| RP:SCP:NREP 1 RP:SCP:REP 12->136|1pvmA4|7e-07|15.2|125/142|d.37.1.1| HM:SCP:REP 1->63|1yavA1|0.00016|24.2|62/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 58->126|1yavA2|6.5e-06|17.4|69/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 66 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222222222222222------222-----11111111----------------------1111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 56.1 SQ:SECSTR ######GEEEGGGcccEETTccHHHHHHHHTTcccEEEEEcccccEEEEEEHHHHHHHHHTccHHHHTccGGGcccccccccccccHHHHHHHTTTccEEEEEcTTccEEEEEETTHHHHHHHHc####################################################################################### PSIPRED cccccccEEHHHEEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEEHHHHHHHHHccccccccHHHHHccccEEEEEEEEEEEEEEEEEEccEEEEEcccccEEEEEEcHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHccccEEEEEccccccEEEEEEEEccccccHHHHHHHHHHHHHcccEEEEHHHHccc //