[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00173.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  116/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->124 PF04307 * DUF457 4e-06 43.9 %
:HMM:PFM   34->124 PF04307 * DUF457 6.2e-23 44.9 69/77  
:BLT:SWISS 33->150 YVSG_BACSU 4e-16 45.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00173.1 GT:GENE ABE00173.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1435222..1435809) GB:FROM 1435222 GB:TO 1435809 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG1988 [R] Predicted membrane-bound metal-dependent hydrolases GB:PROTEIN_ID ABE00173.1 GB:DB_XREF GI:90821534 LENGTH 195 SQ:AASEQ MQAKTHITTTLALGLPLMSLTNELTLVNVGVLAVGSLLPDIDHPSSYLGKRHKMVSGVTNKAFGHRGITHSLLGFILIGIIVKFIQKQYLTDRIENIVFWLMLGYLLHLLEDSFSQRGVKWLYPFTKSGSSFGGKFAFYKTGQLSEYLVMGFMLCLLLMEVRLFWLGNLNRLLPGVVADILKTLILKVQDILNSY GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 33->150|YVSG_BACSU|4e-16|45.8|107/160| TM:NTM 3 TM:REGION 13->35| TM:REGION 67->89| TM:REGION 141->163| RP:PFM:NREP 1 RP:PFM:REP 35->124|PF04307|4e-06|43.9|82/99|DUF457| HM:PFM:NREP 1 HM:PFM:REP 34->124|PF04307|6.2e-23|44.9|69/77|DUF457| OP:NHOMO 117 OP:NHOMOORG 117 OP:PATTERN -----------------------1-------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------11-1-11-----------111111--11111----------1------1-------1---1-1------111-------1---------------------------------------------------1---1-------1-1-1-------------------1-------------------------------------------------------------1----------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-----------------------11-111-1111111111-11111111111111111111111111-11111111111111111111111111111111111111--1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcc //