[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00186.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:242 amino acids
:PSIPRED
:BLT:SWISS 11->145 YTRD_BACSU 4e-04 28.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00186.1 GT:GENE ABE00186.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1455983..1456711) GB:FROM 1455983 GB:TO 1456711 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:NOTE COG0718 [S] Uncharacterized protein conserved in bacteria GB:PROTEIN_ID ABE00186.1 GB:DB_XREF GI:90821547 LENGTH 242 SQ:AASEQ MITFEFKKIKKSAIPITLIFFNLVGSLLGTMIFALNRKVLLDGTQAHVLWGQTVFYSSQIFTPILIGIICSISCQFEESNKNWQRLLSIPVKANRIILSKITSLSLVMAISQLIVLLFYIIIALVLKVPFANYLLDFLLWSITGWIATITIVTIQIFLSIRLKNFAVPILISAILAMAGLMTLFIGQGLFRIFPYAQIAVGDRARSLVPFTLSEFILFLVVNSAYIFVFYTLAVRQLKKRFI GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 11->145|YTRD_BACSU|4e-04|28.5|130/325| TM:NTM 6 TM:REGION 12->34| TM:REGION 54->74| TM:REGION 102->124| TM:REGION 136->158| TM:REGION 171->193| TM:REGION 210->232| OP:NHOMO 26 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1---------------------------------1-----------------------------------------------------------------------------------------------------------------------2--------2----11---11---------1---------------------------------------1-------------1-22-------------------------11---111-----1-----------1----------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //