[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00188.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:302 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   20->220 3dhwC PDBj 1e-28 31.8 %
:RPS:PDB   1->216 2dwoA PDBj 1e-38 8.9 %
:RPS:SCOP  5->225 1b0uA  c.37.1.12 * 1e-35 22.3 %
:HMM:SCOP  11->215 1ii8.1 c.37.1.12 * 3.1e-57 36.6 %
:RPS:PFM   45->161 PF00005 * ABC_tran 1e-10 37.4 %
:HMM:PFM   45->161 PF00005 * ABC_tran 2.9e-20 40.9 115/118  
:HMM:PFM   144->207 PF02463 * SMC_N 0.00035 29.0 62/220  
:HMM:PFM   18->62 PF03193 * DUF258 0.00025 22.7 44/161  
:BLT:SWISS 5->296 BCRA_BACLI 9e-65 46.4 %
:PROS 133->147|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00188.1 GT:GENE ABE00188.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1457448..1458356) GB:FROM 1457448 GB:TO 1458356 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE COG1131 [V] ABC-type multidrug transport system, ATPase component GB:PROTEIN_ID ABE00188.1 GB:DB_XREF GI:90821549 LENGTH 302 SQ:AASEQ MNNYIVETNQLSKDFSGEVAVNQLSIHIRKNEIYGFLGPNGAGKSTAMKMLLGLLQPSHGSIKLFGKTFNSNQISLLSNVGSLIEEPSYYANLTGYENLEIIQKLLKLPKRNIDEVLKIVKLFDQKDKLVKNYSLGMKQRLGIALAIVKFPKLLILDEPTNGLDPAGIQEIRELIKSLPQKYDMTIIVSSHILSEIEQMATTVGIVNHGQLLFEGHLSDLEEDEKYLFETSDDVTAKRILMFNGFNLDDNKKLIINDNNKDNIATAIRLLVENDVDIYQVCMIRRSLEDVFLDMTGREGSVL GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 5->296|BCRA_BACLI|9e-65|46.4|291/306| PROS 133->147|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 246->263|nlddnkkliindnnkdni| BL:PDB:NREP 1 BL:PDB:REP 20->220|3dhwC|1e-28|31.8|201/343| RP:PDB:NREP 1 RP:PDB:REP 1->216|2dwoA|1e-38|8.9|203/449| RP:PFM:NREP 1 RP:PFM:REP 45->161|PF00005|1e-10|37.4|115/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 45->161|PF00005|2.9e-20|40.9|115/118|ABC_tran| HM:PFM:REP 144->207|PF02463|0.00035|29.0|62/220|SMC_N| HM:PFM:REP 18->62|PF03193|0.00025|22.7|44/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 5->225|1b0uA|1e-35|22.3|220/258|c.37.1.12| HM:SCP:REP 11->215|1ii8.1|3.1e-57|36.6|202/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 44868 OP:NHOMOORG 1173 OP:PATTERN SRMBRLINWVWSWSYRiHRNLMMXqKNdhTdTKBEEFBHFHEDSbNUlLP*yj9SgRUYKRKIFX24B QUtJ*WZallkSZTVOLLK-Kb99U*MMMMMKlihjk***TtP*hwjckVYLzrnKMaGGpq*Zxrs***aVSRRsZXaLuXgC9B9CTTTP6RBDI--EHVMLFgPbNS68779799BAAAAAHPMHNSJGONXMillvyKJH*cpkosgfoYfUVHFJHGDefVf***XLKHLJIKKJLEJXRVOKqg9Pj*************************htx**estwyusx**dllnknjikllllkladZhd*eZd**bMZYgttPQ**aXRYiggijqnrrtoy*z*svstpouxruuYYXWXYZaaZYXX*kmeddnlonr*z*********l*nt***gjli*vjz**iqSG**qiYfjnValbnrPZbOMaOQQKHKKJKUR***VLm****************-cd*ZW*b***KC**************FGJ**********MMMMMMMMrSVINjOv555776663456A9AAAAB8C8AAA97A6JACABD***z*******trqsn****ztyxey*******9Qrrizbnei*z****VegIRJLZRIJJJLIIPONRbfcz*NYPrgSZrUUgMdZaQUWhPXWaaZpvZzLMJTHKKLLIFB9FEEEFDDGOHGKJHgiwMpTbLRLtMRTUSMTbRPPSRSaYVbb6-DHNNL221322*r**U*uz*****z*yz-*zy**z**x***yuwywvw*****kmanojjlnmnonkjmjjl*snnvvuwN5************33KIDGCDEJJKKOI*d*bXbYVZJPRNMRPUgNQQOQGTFLRlVrpqqq***nuvqpg***GIIGHJIHIKbkjxmonnou*v*yNKOIKIIJLMFEDE77KURRMNMMAA9A99AA*BYBAA9F-CBE9KEBLLLAIJ9EB99AYnuTUi*imiDgN 3422eYF-VG4FOVMCAD56EHBIAHCFE8A8AEDD6E9B9BAA98CBCGEENEAAF79AB964942324649966624436665734-C95A9577777454KEE2FSWXMRQYRWDEC9GNGefCiD**c4bNcHFH8UCEWTDIDFEVCA*DONMoEX*FaLY8rUW*VaPEGFDD*B87EEhUV*ArfDGlbjdH ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccEEEEEEEEEEEEccEEEEcccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccccccccHHHHHHHccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEEEccEEEEEccHHHHHHcccEEEEEcccccHHHHHHccccccccccEEEEcccccccHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHccccccc //