[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00191.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  47/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
:187 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   69->163 PF04140 * ICMT 1e-10 33.7 %
:HMM:PFM   75->164 PF04140 * ICMT 1.9e-16 27.0 89/94  
:HMM:PFM   35->79 PF07695 * 7TMR-DISM_7TM 0.00031 27.3 44/205  
:BLT:SWISS 40->178 ICMT_ORYSJ 1e-12 28.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00191.1 GT:GENE ABE00191.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1460314..1460877) GB:FROM 1460314 GB:TO 1460877 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:NOTE COG2020 [O] Putative protein-S-isoprenylcysteine methyltransferase GB:PROTEIN_ID ABE00191.1 GB:DB_XREF GI:90821552 LENGTH 187 SQ:AASEQ MDLQSIFTYGFILIFIITETWIKRKTKSNNENNSEDKGSRYIIIGSIVCCLLLMNEQLLPSIAQLPHFLIYIGILLSLAGFVLRIYTVNYLGKNFTLAVQTTDSQQLVEAGPYSIVRNPAYTGSIVSILGLSFVSLNPLTIIICLILLVVGYSIRLKVEEKALHNHFGKAYETYCQKVRYRIFPYIW GT:EXON 1|1-187:0| BL:SWS:NREP 1 BL:SWS:REP 40->178|ICMT_ORYSJ|1e-12|28.3|138/191| TM:NTM 4 TM:REGION 1->22| TM:REGION 39->61| TM:REGION 67->89| TM:REGION 128->150| SEG 139->148|ltiiiclill| RP:PFM:NREP 1 RP:PFM:REP 69->163|PF04140|1e-10|33.7|92/95|ICMT| HM:PFM:NREP 2 HM:PFM:REP 75->164|PF04140|1.9e-16|27.0|89/94|ICMT| HM:PFM:REP 35->79|PF07695|0.00031|27.3|44/205|7TMR-DISM_7TM| GO:PFM:NREP 3 GO:PFM GO:0004671|"GO:protein-S-isoprenylcysteine O-methyltransferase activity"|PF04140|IPR007269| GO:PFM GO:0006481|"GO:C-terminal protein amino acid methylation"|PF04140|IPR007269| GO:PFM GO:0016021|"GO:integral to membrane"|PF04140|IPR007269| OP:NHOMO 79 OP:NHOMOORG 67 OP:PATTERN ------1--------1----------------------------1-----11---------------- -1------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------1--------------111------------------------1------------11-----------------------------1----1----------------------1------------11111111111---------11--1-----11---1-----------------------1----------------------------------------------1222122--------1------2----11----1----------------------------------------------------------------1-------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----1-------------------------------------111-----------------1-------------------------131-24--------1---1----------------------------------------------------------------------------1-11----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,25-37| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccc //