[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00196.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->79 PF08722 * TnsA_N 0.00085 17.8 45/88  
:HMM:PFM   102->146 PF05851 * Lentivirus_VIF 0.001 39.0 41/251  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00196.1 GT:GENE ABE00196.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1465187..1465660) GB:FROM 1465187 GB:TO 1465660 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00196.1 GB:DB_XREF GI:90821557 LENGTH 157 SQ:AASEQ MSEIIENISFQEYCLTRNRVAILLNILGKEHKKDTTQEKLIISDFFLKFPELISDEIELGRFDIKYSYFHWKPNYKLYNAVLADLLARNIITFNSLNNRYFITDKGEKFVIELFSEEGIDWSKILQSCDFIVSKVLNKTVSAGQTMIQSKLDCIRGN GT:EXON 1|1-157:0| HM:PFM:NREP 2 HM:PFM:REP 26->79|PF08722|0.00085|17.8|45/88|TnsA_N| HM:PFM:REP 102->146|PF05851|0.001|39.0|41/251|Lentivirus_VIF| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,157-158| PSIPRED cHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEcccHHHHHHHHHHHHHHccEEEEccccEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //