[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00202.1
DDBJ      :             Ribonuclease M5
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  173/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.136.1e.10.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   9->160 1cy0A PDBj 3e-09 14.7 %
:RPS:SCOP  9->160 1cy0A  e.10.1.1 * 1e-09 14.7 %
:HMM:SCOP  4->127 2fcjA1 c.136.1.1 * 1.1e-29 43.8 %
:HMM:PFM   9->77 PF01751 * Toprim 3.2e-05 20.3 69/96  
:HMM:PFM   66->134 PF01983 * CofC 0.00099 25.0 68/217  
:BLT:SWISS 5->184 YABF_BACSU 3e-38 44.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00202.1 GT:GENE ABE00202.1 GT:PRODUCT Ribonuclease M5 GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1469230..1469799) GB:FROM 1469230 GB:TO 1469799 GB:DIRECTION - GB:PRODUCT Ribonuclease M5 GB:NOTE COG1658 [L] Small primase-like proteins (Toprim domain) GB:PROTEIN_ID ABE00202.1 GB:DB_XREF GI:90821563 LENGTH 189 SQ:AASEQ MINRIKISQVIVAEGRDDTTNLKRYFDVETYETRWSAINDQDIERIQRLHELHGVIVFTDPDFNDERIRRMIITVIPTVQHVFLKRDEAVPKSKTKGRSLGIEHASYEDLKTALAQVTEQFKNENEFDISRSDLIRLGFLAGADSRKRREYLGEQLRIGYSNGKQLLKRLELFGVTLAEVKEAMTKYSI GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 5->184|YABF_BACSU|3e-38|44.3|176/186| RP:PDB:NREP 1 RP:PDB:REP 9->160|1cy0A|3e-09|14.7|136/534| HM:PFM:NREP 2 HM:PFM:REP 9->77|PF01751|3.2e-05|20.3|69/96|Toprim| HM:PFM:REP 66->134|PF01983|0.00099|25.0|68/217|CofC| RP:SCP:NREP 1 RP:SCP:REP 9->160|1cy0A|1e-09|14.7|136/534|e.10.1.1| HM:SCP:REP 4->127|2fcjA1|1.1e-29|43.8|112/0|c.136.1.1|1/1|Toprim domain| OP:NHOMO 174 OP:NHOMOORG 173 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111-11111111111111-1111111-1-11---1-11-------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-----1----1---1--1-----111--111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 72.0 SQ:SECSTR ########EEEEEccHHHHHHHGGGcEcccHHHHHTEETTTTTEHHHHHHHHHTEEEcccccHHHHHHHHHHH##############HHHcccGGGEEEcccccccHHHHHHHHHccccccHHHHHHHHHHHHHHH##HHHHHHHHHHHHHTcTTccccT############################# DISOP:02AL 1-5,90-99| PSIPRED ccccccccEEEEEEcccHHHHHHHHHcEEEEEEccEEccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHccccEEEEEcHHHcccccccccccEEEEEccHHHHHHHHHHccccccccccccccHHHHHHccccccccHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHccc //