[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00205.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   4->134 PF09716 * ETRAMP 4.5e-05 27.8 54/84  
:BLT:SWISS 29->90 SYFA_RUTMC 7e-04 29.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00205.1 GT:GENE ABE00205.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1471249..1471695) GB:FROM 1471249 GB:TO 1471695 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID ABE00205.1 GB:DB_XREF GI:90821566 LENGTH 148 SQ:AASEQ MKKKINRCLLSFLILFLALFLTGFRKMKTSDYNKVRGVIVENSNKVGLHGKVTITKLYWTALEIPTYHVTYTYSEKTYLDQKVVLEKNTAIHEKGSSDSYGNVPEYKESFLKQKSVQKVEKKTEKQLKKQKLGLPISSFSFLSNFNHA GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 29->90|SYFA_RUTMC|7e-04|29.0|62/100| TM:NTM 1 TM:REGION 5->24| SEG 9->21|llsflilflalfl| SEG 111->134|lkqksvqkvekktekqlkkqklgl| HM:PFM:NREP 1 HM:PFM:REP 4->134|PF09716|4.5e-05|27.8|54/84|ETRAMP| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 37.2 SQ:SECSTR #######################EEEEEccTTcEEcccccTTTcccEEEEEEEcHHHHHHHHTcccccEEEEEcccEE###################################################################### DISOP:02AL 1-4,113-130,147-149| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHEEEEEEEcccEEEEEEEEEEEEEEEEEEcccEEEEEEEEccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccc //