[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00245.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->127 2atrA PDBj 2e-09 34.7 %
:RPS:PDB   12->129 3e0kA PDBj 4e-08 15.8 %
:RPS:SCOP  13->120 2atrA1  d.108.1.1 * 1e-14 26.5 %
:HMM:SCOP  1->129 1y7rA1 d.108.1.1 * 1.1e-09 22.2 %
:HMM:PFM   45->120 PF00583 * Acetyltransf_1 4.7e-09 23.7 76/83  
:BLT:SWISS 36->126 NSI_ORYSJ 2e-04 35.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00245.1 GT:GENE ABE00245.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1500879..1501271) GB:FROM 1500879 GB:TO 1501271 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00245.1 GB:DB_XREF GI:90821606 LENGTH 130 SQ:AASEQ MDLKVNPKFNKGELLNLYAALGRKDELENYDCFRKSLKKSYVIAAYDQGRLAGLVNAISDNATTVYVKDLLISPNFDKSKVGKFLIEHLKSYYKAVPKIIISTSDTDTSELVLLKSVGFEEQDQKILEYS GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 36->126|NSI_ORYSJ|2e-04|35.8|81/254| BL:PDB:NREP 1 BL:PDB:REP 13->127|2atrA|2e-09|34.7|101/127| RP:PDB:NREP 1 RP:PDB:REP 12->129|3e0kA|4e-08|15.8|114/144| HM:PFM:NREP 1 HM:PFM:REP 45->120|PF00583|4.7e-09|23.7|76/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 13->120|2atrA1|1e-14|26.5|102/132|d.108.1.1| HM:SCP:REP 1->129|1y7rA1|1.1e-09|22.2|126/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------1-1--------------1--------------------------111---111---------------------211---1------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 90.8 SQ:SECSTR ###########HHHHHHHHHHHHTTcccccHHHHHHTHGGGEEEEEETTEEEEEEEEEEEGGGTEEEEEEEEcGGGccccHHHHHHHHHHHHHTHTcTTccEEEccccccHHHHHHHTcccccGGGccG# DISOP:02AL 1-1,125-127,130-131| PSIPRED ccccccccccHHHHHHHHHHcccccccccHHHHHHHHcccEEEEEEEccEEEEEEEEEEcccEEEEEEEEEEcHHHccccHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHcccEEcccEEEccc //