[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00246.1
DDBJ      :             Amino acid permease
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  204/915 : Eukaryota  136/199 : Viruses  0/175   --->[See Alignment]
:439 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->256 3hqkD PDBj 8e-11 24.6 %
:RPS:PFM   19->428 PF00324 * AA_permease 2e-18 29.0 %
:HMM:PFM   20->413 PF00324 * AA_permease 1.2e-45 23.1 390/479  
:BLT:SWISS 10->439 STET_BACSU 1e-89 39.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00246.1 GT:GENE ABE00246.1 GT:PRODUCT Amino acid permease GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1501521..1502840 GB:FROM 1501521 GB:TO 1502840 GB:DIRECTION + GB:PRODUCT Amino acid permease GB:NOTE COG0531 [E] Amino acid transporters GB:PROTEIN_ID ABE00246.1 GB:DB_XREF GI:90821607 LENGTH 439 SQ:AASEQ MPENKNHVQLQRSLGLYSALSLVIGTIIGSGIFFKQSSILANAHTTTMAIAAWVIGGIITLTSGLTIAEIGSLFPHTGGLYVYIEKIYGKFWGFLAGWVQIIVYGPALIASLGAYLAILIGAFFHFPRTWTPAIAIISILLISLFNLLSNRFGAALQIFTTLCKMVPIFLIIICGILFGDEHALGQVVSNGQASIGNFGVAVLATLFAYDGWILIANLGGEIKNPQKILPLAIILGTSFVLIVYVLLTVGIFKAMPANQITKLGENAAPYFAIKMFGSIGGKILNLGIIISIIGTINGKIMTFPRIMFAMARANELPFSKQLAWLHPRMFSPVVSVLTMFSFASILILFFNPDRLSEICIFSIYCFYLIAFFGLFKLRKQRKDLVRPFKVPLYPLTPIIAILGAIFVMLSEIFSDLNGVLVSFIFILIGVPVYYWKVKK GT:EXON 1|1-439:0| BL:SWS:NREP 1 BL:SWS:REP 10->439|STET_BACSU|1e-89|39.7|428/438| TM:NTM 12 TM:REGION 13->35| TM:REGION 50->72| TM:REGION 96->118| TM:REGION 128->150| TM:REGION 158->180| TM:REGION 195->217| TM:REGION 230->252| TM:REGION 267->289| TM:REGION 330->351| TM:REGION 355->376| TM:REGION 387->409| TM:REGION 413->434| SEG 133->150|aiaiisillislfnllsn| SEG 168->179|ifliiicgilfg| SEG 277->300|gsiggkilnlgiiisiigtingki| BL:PDB:NREP 1 BL:PDB:REP 14->256|3hqkD|8e-11|24.6|228/419| RP:PFM:NREP 1 RP:PFM:REP 19->428|PF00324|2e-18|29.0|393/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 20->413|PF00324|1.2e-45|23.1|390/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 1033 OP:NHOMOORG 353 OP:PATTERN ------1-11111--------------21-1------------1-----------------111---- 368---------1------------------------1----------------1----------1-11------------------------------2-11--2-231----------------11------------------1-1-----------------1-----------------------1-12222223232232323--11321312--1-2-------1-2111111111111111----1321111211333111-11211----1111------------------------------------------2-14444444-3--222-2111-------1-11-------1-------3-----1---1----11-------------------------------------1----11-1--1--------------------------------------------------1---------------122-21-----1121-----11--2-------1-----------------1---------------------1---1-----------11-------------------------------2---------1-----1111--------11---1--------------1-----111-1---11-1111---1-11--11111--------------------------11----1------------------11-11----1-------------------------------2222-111-1-11-----------------------------12-1--11---------111111---------------1----1------1---1--------------11- ------1-----1111112211124321112221111111112-11-11112211121-22211-------------------------11312121-11-11221----NNN9CCF6444595CA587Ld81C9A4643E66A556642924A4AAC8FKe4FB81A6596891-------------12----2222- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 367 STR:RPRED 83.6 SQ:SECSTR ###########cccccHHHHHHHHHHHTTcHHHHHHHHHHHGHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccccHHHHHHHHHHHHTTTcTTcHHHccHHHHHHTTTTHHHHTccccccccccHTTTcccccTTTHHHHHHHHHHTTTcHHHHHHHHHcccccccTTHHHHHHHHHHHHHHHHHHHHTTTTcccccHHHHHHTcTTHHHHHTHHHHcHHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHcccccccTTcc#####cccTHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHTHHHHcccHH######################################################## DISOP:02AL 1-12| PSIPRED ccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHEEEc //