[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00253.1
DDBJ      :             Hypothetical exported protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->124 PF02450 * LACT 5.4e-05 19.4 108/394  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00253.1 GT:GENE ABE00253.1 GT:PRODUCT Hypothetical exported protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1507515..1507994) GB:FROM 1507515 GB:TO 1507994 GB:DIRECTION - GB:PRODUCT Hypothetical exported protein GB:NOTE COG0744 [M] Membrane carboxypeptidase (penicillin-binding protein) GB:PROTEIN_ID ABE00253.1 GB:DB_XREF GI:90821614 LENGTH 159 SQ:AASEQ MAYRTPPFITPFAILSAVLALGATNVAVNTATGTSEGKPKVERVSTSTVSSSFSSNSEQDNSKMSSSQSDDKKHDSSSYDNSENDQNQDTNSTTDDGNTNGNNKSYSSSTKTTDNTTGGTTTNNNNTNSNDTTTDSNNTTGNTTTNNNTTGGTTTNNNQ GT:EXON 1|1-159:0| TM:NTM 1 TM:REGION 6->28| SEG 20->34|algatnvavntatgt| SEG 44->82|vststvsssfssnseqdnskmsssqsddkkhdsssydns| SEG 84->158|ndqnqdtnsttddgntngnnksyssstkttdnttggtttnnnntnsndtttdsnnttgntttnnnttggtttnnn| HM:PFM:NREP 1 HM:PFM:REP 8->124|PF02450|5.4e-05|19.4|108/394|LACT| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,40-40,46-137,147-160| PSIPRED ccccccccccHHHHHHHHHHHccccEEEEcccccccccccEEEEEccccccccccccccHHHHHHcccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //