[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00255.1
DDBJ      :             Amino acid permease
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  565/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
:465 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->392 3gi9C PDBj 4e-13 22.6 %
:RPS:PFM   53->429 PF00324 * AA_permease 5e-26 33.5 %
:HMM:PFM   32->436 PF00324 * AA_permease 3.8e-42 23.7 392/479  
:BLT:SWISS 7->462 YHDG_BACSU 3e-79 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00255.1 GT:GENE ABE00255.1 GT:PRODUCT Amino acid permease GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1508743..1510140 GB:FROM 1508743 GB:TO 1510140 GB:DIRECTION + GB:PRODUCT Amino acid permease GB:NOTE COG0531 [E] Amino acid transporters GB:PROTEIN_ID ABE00255.1 GB:DB_XREF GI:90821616 LENGTH 465 SQ:AASEQ MGILNRILRKESLERYLDSDNHLERIIGTKDLIAMGIGVVIGTGIFILPGTVAATHSGPAITISFILAAIVCSTSALCYAEFSSALPVAGSAYSFGNVIFGELIGWILGWALILEYMLAVAAVATGWASYFNSFIAGFGIHIPKAVSGPFNPAQGTYVNLTAILIVLFISFLLSRGVQASIRLNNIMVYLKIAIILLFVIVGAFFVKPANWNPYMPFGIKGVFTGASTVFFAYLGFDVIASSAAEVKNPKRSMPAGILGTLSITTVLYIAVAAVLTGMVKYTKLDVGNPVSYAMQLAHQDWFAGIIALGALIGMFTMILSTTFSSSRLIYSIGRDGLLPASLSKLDEKTHTPKVALYAVTVVIALTSGFVSLDQLANLVNIGTLVAFTVVSLGVIPLRRRKDIDNSKGFKVPFYPVLPIVSVVLCLIMLSQLSLETWVASGIWFLIGLIIYFSYGIKHSKLSGNK GT:EXON 1|1-465:0| BL:SWS:NREP 1 BL:SWS:REP 7->462|YHDG_BACSU|3e-79|38.3|454/465| TM:NTM 12 TM:REGION 29->51| TM:REGION 58->80| TM:REGION 94->116| TM:REGION 156->178| TM:REGION 187->209| TM:REGION 220->242| TM:REGION 255->277| TM:REGION 301->323| TM:REGION 352->374| TM:REGION 376->397| TM:REGION 411->433| TM:REGION 436->458| SEG 36->47|gigvvigtgifi| SEG 101->115|geligwilgwalile| SEG 163->174|ilivlfisflls| BL:PDB:NREP 1 BL:PDB:REP 52->392|3gi9C|4e-13|22.6|318/437| RP:PFM:NREP 1 RP:PFM:REP 53->429|PF00324|5e-26|33.5|361/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 32->436|PF00324|3.8e-42|23.7|392/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 3107 OP:NHOMOORG 752 OP:PATTERN ---1--21-1111121131----133334234--1-1------31-12-32221---1-1-4651--1 485-3---11122-22232-351183333333277727CA----2121-221B574-4----2223D84414111333--214-111111-111-----2-231-42542--------------211111--11-1------------------------------1---1-------------------151C999999998689B8921779B798635616133333351433333333333333355462771341644566994345744322211121112221111111111122222222222222112221111--1532323333-1--5441211-1----11111112--1115--41---5-13222-211133--3---121------------1-22122122-1-----1------11-211---1------13333333323323-------------111111111111111-----213231---19CBAC937674AA52777748C834453-1222-11--21-111----11231-------111-------1---21------------1-----11------------------1-----131--1221--1-----2222------1-11111-1--1---------56445557664743466-6676544646645666664898574438866888888888768866566561-644344444545--2-4344323221--21--------1-1-111AAA977511--1788889661CEBA2345111-12--1-1-1------11-1166677777793333----221111--------1----------------------------1--------1-1 ----54----1-65111--11-2141222211111-1212-12-111-211-1----1-111-1--1-11----1---11111-2--1-1--1111-------232----EKNBHGE66567D5IE5C7NoD2CCG3764P88OB58556P95F69CCABQo24956B68TBC62222-71114599AH19613C7BB- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 403 STR:RPRED 86.7 SQ:SECSTR ###############################################HHHHHHHHHTGGGHHHHHHHHHHHHHHHHHHHHHHcTTTHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcc##########TcccccccHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHccccHHHHHHHHHHHHHTTGGGTHHHHHHTTGGGcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHTcccTTHHHHHTHHHHcHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHccccccccTccTcccccTHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTTccccHHHHHHHHHHHHHHHHHHH####HHccHHHHHHHHHHHHHHHHHHHHcTTTccc# DISOP:02AL 1-2,9-26,462-466| PSIPRED ccHHHHHcccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHccccccc //