[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00263.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:227 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->224 1l2tB PDBj 6e-53 44.2 %
:RPS:PDB   2->222 3b5jA PDBj 6e-49 24.4 %
:RPS:SCOP  1->217 1sgwA  c.37.1.12 * 2e-45 21.3 %
:HMM:SCOP  4->220 1ii8.1 c.37.1.12 * 1.5e-68 36.5 %
:RPS:PFM   79->169 PF00005 * ABC_tran 5e-17 45.1 %
:RPS:PFM   142->211 PF02463 * SMC_N 5e-04 33.8 %
:HMM:PFM   45->169 PF00005 * ABC_tran 2.7e-26 35.3 116/118  
:HMM:PFM   21->51 PF03193 * DUF258 2.5e-06 33.3 30/161  
:HMM:PFM   189->215 PF04064 * DUF384 0.00092 52.2 23/58  
:BLT:SWISS 1->220 YKNY_BACSU 2e-59 51.1 %
:PROS 142->156|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00263.1 GT:GENE ABE00263.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1519933..1520616) GB:FROM 1519933 GB:TO 1520616 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE COG1136 [V] ABC-type antimicrobial peptide transport system, ATPase component GB:PROTEIN_ID ABE00263.1 GB:DB_XREF GI:90821624 LENGTH 227 SQ:AASEQ MIRLENINKYYQQGDSQFHVLHDINLNIDAGELVAIIGESGSGKSTLINIIGFLDDKFEGTYYYNDEPIHDYNRKDFSKLRNENVGFVFQNFKLLRDVSVAENVALPLLYAGKKRAEIKERVSEVLSKVGLAGYENKLPKNMSGGQQQRVSIARAIATNPKFLIADEPTGALDTQTSQEIMNLFKELNRESHTTIILVTHDPHVAEQCERVVTILDGHMIKDERNEI GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 1->220|YKNY_BACSU|2e-59|51.1|219/230| PROS 142->156|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->224|1l2tB|6e-53|44.2|224/232| RP:PDB:NREP 1 RP:PDB:REP 2->222|3b5jA|6e-49|24.4|217/243| RP:PFM:NREP 2 RP:PFM:REP 79->169|PF00005|5e-17|45.1|91/123|ABC_tran| RP:PFM:REP 142->211|PF02463|5e-04|33.8|68/536|SMC_N| HM:PFM:NREP 3 HM:PFM:REP 45->169|PF00005|2.7e-26|35.3|116/118|ABC_tran| HM:PFM:REP 21->51|PF03193|2.5e-06|33.3|30/161|DUF258| HM:PFM:REP 189->215|PF04064|0.00092|52.2|23/58|DUF384| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 1 RP:SCP:REP 1->217|1sgwA|2e-45|21.3|197/200|c.37.1.12| HM:SCP:REP 4->220|1ii8.1|1.5e-68|36.5|211/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 53132 OP:NHOMOORG 1175 OP:PATTERN RRMCSKIKXXZVXUaMiLQQMQLaxOQjmVgZKFEDEDHGIFBVZUXpNT**lAQbOVTNSKKFa199 UbpK*fgemmpUfPaUYRQ-QeBBY*RRRRRQuppqu***Q*X*r*vbuqhT***OSkFGxw*m*t****fhedd*gegQ*kiDBEBDZZWP6RGLM-1JHWONNmQcSW9A9999ADDDCCCCJWSNVdSPZYdUjtt**ONN*Y*ms*iiogiUWQGLLQKghbn***dKRHNMLLRKOHLmZgSR*qCah*************************jq***nt*zzxyx**cqrrrrooorqqqpqemhih*kcg**gQiaq*zQR**gZRcopnkmvuzyvt**z*y*zywu**wxzefeddfihhhgee*srkiirpsps***********l*ow***gonk*yo***jsUM**ynaejnTbmgsrRjfZPbWVVLNNNMNhZ***ZXs****************-rv*nk*q***SC**************LMK**********RQRRRRRR*ZcKSoZ*77667777667897CD9AAA9999A86A6LEDFDE***************z********m********DN**w*s*ou******btpQYLUpaHJIIKIISSRYqog**UnZ*qXpzdcqKfbbYWbnXcbcYco*a*OOMTHPPPQPJDEEEEEDEEJWHHLRQxv*S*XjNYP*TYbcYPZfZVVXZZcbZed5-FLZRO331544****b************-******************z*****rtovxquvxvwwwtuwuus*ysuzzz*X5************44LGFIFFGQSTRPK*r*gfeefcNUXURZTXlPRTRRHUHQVvi********z****n***FGFDEGFEGOmwv*uuvvu*****RTUOQPOMOOGFFF88NWUUMNOPCB9AB999*DdEDDEH-IEHGLJFSSPDKRELIBBCfp*aZx*xvuFeN 2355mgK-ePA7ReTFCLGEJQJSGUJGGCDCDLIKDIHHGFHBAAIHJQONVTJKNBFCDDA788B83BA4ACG893AA8A9A8C5A-FLACGDKCCBC96HLFG5XfqrVaWpfjMHHDLaLuo9*G**p3rUqOIHChDLkUCQGFDiDC*FXTTwLm*SzRfG*am*ZkjRJHCK*GJHJQ*dg*G*tHM*mz*X ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 222-228| PSIPRED cEEEEEEEEEEccccEEEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHcccHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHccEEEEEEccEEEEEccccc //