[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00267.1
DDBJ      :             Lactoylglutathione lyase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  135/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->127 3huhA PDBj 2e-21 37.4 %
:RPS:PDB   3->128 2ei1A PDBj 8e-15 11.0 %
:RPS:SCOP  1->128 1cjxA1  d.32.1.3 * 3e-16 8.1 %
:HMM:SCOP  3->124 1lqpA_ d.32.1.2 * 2.4e-18 31.8 %
:RPS:PFM   5->123 PF00903 * Glyoxalase 2e-04 34.5 %
:HMM:PFM   5->124 PF00903 * Glyoxalase 3.7e-10 23.7 118/128  
:BLT:SWISS 3->128 GLOD5_DANRE 2e-21 37.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00267.1 GT:GENE ABE00267.1 GT:PRODUCT Lactoylglutathione lyase family protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1524346..1524732 GB:FROM 1524346 GB:TO 1524732 GB:DIRECTION + GB:PRODUCT Lactoylglutathione lyase family protein GB:NOTE COG0346 [E] Lactoylglutathione lyase and related lyases GB:PROTEIN_ID ABE00267.1 GB:DB_XREF GI:90821628 LENGTH 128 SQ:AASEQ MKIKRLDHIVLTVSDLAQAERFYHEVFDMPVIKDQTTEDVITLRCGHQLIRLRKADKNSDLRANNQTIGAADICIVSGDKMSDIENHLKSYFVNIVAGPMTKMGSEGEMTSIYLRDYDQNLIEISTYK GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 3->128|GLOD5_DANRE|2e-21|37.9|124/163| BL:PDB:NREP 1 BL:PDB:REP 3->127|3huhA|2e-21|37.4|123/124| RP:PDB:NREP 1 RP:PDB:REP 3->128|2ei1A|8e-15|11.0|118/293| RP:PFM:NREP 1 RP:PFM:REP 5->123|PF00903|2e-04|34.5|110/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 5->124|PF00903|3.7e-10|23.7|118/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->128|1cjxA1|3e-16|8.1|123/150|d.32.1.3| HM:SCP:REP 3->124|1lqpA_|2.4e-18|31.8|107/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 212 OP:NHOMOORG 188 OP:PATTERN -------------------------------------------------------------------- --------------1---------11-----1----------------------------------1-----------------------------------------------------------------------------------11-------------------------------------------------------------1-----------------11----------------------1----1---1111---11------------------------------------------------------------------------------------------------------------------111--1-----1111111111-------1---1--1--111-1-1---------1-------1111111111111-------------------------------------1----1111111-----111-------1-1--11----1----1----1-1111--111---------------------------------------------1-1----------------------2211----------1111---1111-1--1--------1----------1------------------------------------1--11-1---1---1-1--1-------------------------------------1-1---------------------------1111-1--1---11111----------111131231--1111---------1111----------------------------------------------------------- ----11----------1-------1----------------------1-----1-1--------1----------1---1------------1---------1------122-51111111-1-11111381--11-1-11111-----11--111113----11--------11----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 100.0 SQ:SECSTR TTEEEEEEEEEEEccHHHHHHHHHHTTccEEEccccccEEEEcccccccEEEEEccccccccTccEEEEEEEEEccHHHHHHHHHHHHHHTTcccEEccHHHHHHHTEEEEEEEEcTTccEEEEEEEE DISOP:02AL 1-1| PSIPRED ccEEEEEEEEEEEccHHHHHHHHHHHcccEEEEEccccEEEEEEEcccEEEEEEccccccccccccccccccEEEEEcccHHHHHHHHHHcccEEEccccccccccccEEEEEEEcccccEEEEEEEc //