[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00293.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->77 PF09639 * YjcQ 9.6e-05 22.0 50/88  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00293.1 GT:GENE ABE00293.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1544970..1545209) GB:FROM 1544970 GB:TO 1545209 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00293.1 GB:DB_XREF GI:90821654 LENGTH 79 SQ:AASEQ MAKATNEDKNIEVSESGKKFIKGTHVEFKFHRHTFTGVVDKQLHNSAMIIFDDEYNKSITYQDAKGKIIISYSKMQIIK GT:EXON 1|1-79:0| HM:PFM:NREP 1 HM:PFM:REP 26->77|PF09639|9.6e-05|22.0|50/88|YjcQ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccccccccccEEEEccccccccccEEEEEEccccccEEEEEEcccEEEEEEEcccccEEEEEEccEEEEEEHHHcEEEc //