[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00300.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00300.1 GT:GENE ABE00300.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1552734..1553255) GB:FROM 1552734 GB:TO 1553255 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00300.1 GB:DB_XREF GI:90821661 LENGTH 173 SQ:AASEQ MRDNKNNTQTSENKSEVTIKKNSSSSKKKSSTSKKESSSKKNSTSGKSSSSSSRIKTEEVYNEKRDQSNVDVTNLTVSQCLLWALSERYSDQNADEQSWDMLKESIDSAEVVPATKSDDDYVHIYFNYGSEECNYYIDGNYDLCTEEDDEVVSRYPTEFENEKANNYIMTRYE GT:EXON 1|1-173:0| SEG 20->53|kknsssskkksstskkessskknstsgkssssss| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-62,173-174| PSIPRED cccccccccccccccEEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHEEccccccccEEEEEEEcccccccEEEEcccccccccHHHHHHHccccccccccccEEEEEEc //