[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00321.1
DDBJ      :             Glucosyltransferase-S
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.109.1
:304 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   149->301 2bibA PDBj 3e-13 35.9 %
:RPS:PDB   141->277 1e88A PDBj 2e-07 14.6 %
:RPS:SCOP  148->299 2bibA1  b.109.1.1 * 6e-16 30.9 %
:HMM:SCOP  80->306 2bibA1 b.109.1.1 * 9.2e-26 32.0 %
:HMM:PFM   191->203 PF01473 * CW_binding_1 0.00018 61.5 13/19  
:HMM:PFM   214->228 PF01473 * CW_binding_1 0.00089 53.3 15/19  
:BLT:SWISS 2->61 ASA1_ENTFA 7e-04 40.8 %
:BLT:SWISS 129->304 TOXA_CLODI 3e-12 31.0 %
:REPEAT 4|148->168|187->212|213->232|254->279
:REPEAT 3|169->186|233->250|280->300
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00321.1 GT:GENE ABE00321.1 GT:PRODUCT Glucosyltransferase-S GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1579413..1580327) GB:FROM 1579413 GB:TO 1580327 GB:DIRECTION - GB:PRODUCT Glucosyltransferase-S GB:NOTE COG5263 [R] FOG: Glucan-binding domain (YG repeat) GB:PROTEIN_ID ABE00321.1 GB:DB_XREF GI:90821682 LENGTH 304 SQ:AASEQ MERKTHYKMYKAGKNWVFAMLSTVALTGVMAMSGNTAKADAVAQSSTEQVAKVDTTGATTTQVEKATNNVNESNAAQTSVTTTTGQSSSNADATSSSQNNKQATTTSVVTSQNTLVANKDQASSIQSSVTQNSKKTETVINTADNASQKNVNGNWYLVDNNTGKNLTGFQEIKYQNKVVYYAPSNAQMQYGWQDINNNRYYFDTFDGAMTTGQKNINGNWYMFDAQGVLQTGFQRIESQNKTVYYSEDKDKLGQMQYGQKNIKGNWYNFDTYDGAMKTGFVTIPSQNKTVYYSEDKAKLGQMQY GT:EXON 1|1-304:0| BL:SWS:NREP 2 BL:SWS:REP 2->61|ASA1_ENTFA|7e-04|40.8|49/100| BL:SWS:REP 129->304|TOXA_CLODI|3e-12|31.0|171/2710| NREPEAT 2 REPEAT 4|148->168|187->212|213->232|254->279| REPEAT 3|169->186|233->250|280->300| SEG 73->100|snaaqtsvttttgqsssnadatsssqnn| BL:PDB:NREP 1 BL:PDB:REP 149->301|2bibA|3e-13|35.9|142/540| RP:PDB:NREP 1 RP:PDB:REP 141->277|1e88A|2e-07|14.6|130/160| HM:PFM:NREP 2 HM:PFM:REP 191->203|PF01473|0.00018|61.5|13/19|CW_binding_1| HM:PFM:REP 214->228|PF01473|0.00089|53.3|15/19|CW_binding_1| RP:SCP:NREP 1 RP:SCP:REP 148->299|2bibA1|6e-16|30.9|139/232|b.109.1.1| HM:SCP:REP 80->306|2bibA1|9.2e-26|32.0|194/0|b.109.1.1|1/1|Cell wall binding repeat| OP:NHOMO 164 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------4-H-----------------------------------------------------------------------------------------------------------------------1----------------------1----------------------------------------------5-11-2---------41174454554554-------------1------------1I-------F-K-2---564-------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 56.2 SQ:SECSTR ##################################################################################################################################EccccEEEEcEEETTTEEEcccEEEEEEcccEEEcccccccEEccccccccGGGTcccccccEEETTEEEcccccccccccccEEEccccHHHHcTccccEEEccTTccccccEEcccETcTTccccccEEETTEEEcccccTTccccccEEEETEEcEEEEEcTTccccc### DISOP:02AL 1-3,42-67,69-74,77-106| PSIPRED ccccEEEEEEEEccEEEEHHHHHHHHHHHHHHcccEEEEEEEEcccEEcccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccEEEcccEEEcccEEEEcccccEEEEEEEEEccEEEEEccccEEEEEEEEEccEEEEEEcccccEEEcEEEEEccccEEEEEccccEEEccEEEEccEEEEEEccccEEEEEEEEEccEEEEEcccccEEEEEEEEEccccEEEEEcccccEEEEEEEEEEEccEEEEEcccccEEEEEEEEEcccccEEEEEccccEEEEEcc //