[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00347.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->104 2q5zB PDBj 2e-04 32.1 %
:RPS:PDB   1->102 2a3qA PDBj 1e-08 17.3 %
:RPS:SCOP  1->103 2a3qA1  a.204.1.2 * 3e-09 19.4 %
:HMM:SCOP  1->104 2a3qA1 a.204.1.2 * 1.6e-21 30.7 %
:HMM:PFM   26->102 PF03819 * MazG 3.5e-13 37.7 61/74  
:BLT:SWISS 22->104 YPJD_BACSU 5e-05 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00347.1 GT:GENE ABE00347.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1621105..1621428 GB:FROM 1621105 GB:TO 1621428 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:NOTE COG1694 [R] Predicted pyrophosphatase GB:PROTEIN_ID ABE00347.1 GB:DB_XREF GI:90821708 LENGTH 107 SQ:AASEQ MDINEHQQWLVKFYEKRDWFKYPPQDRVNYITEELGELSRAVRTIEVGRDHPGEKILNQAEKEDNLREEMADVIDQVLVLAAKYDIKPDELLEYSENKLKKRFNMDV GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 22->104|YPJD_BACSU|5e-05|35.6|73/111| BL:PDB:NREP 1 BL:PDB:REP 20->104|2q5zB|2e-04|32.1|78/94| RP:PDB:NREP 1 RP:PDB:REP 1->102|2a3qA|1e-08|17.3|98/112| HM:PFM:NREP 1 HM:PFM:REP 26->102|PF03819|3.5e-13|37.7|61/74|MazG| RP:SCP:NREP 1 RP:SCP:REP 1->103|2a3qA1|3e-09|19.4|98/113|a.204.1.2| HM:SCP:REP 1->104|2a3qA1|1.6e-21|30.7|101/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 44 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-1111111---1---------11--------------------1-1-1----------11-1--11---211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------1--------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 97.2 SQ:SECSTR ccHHHHHHHHHHHHHTccHHHHcHHHHHHHHHHHHHHHHHHHTTccccHHcccccGGGcHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHcHc### DISOP:02AL 1-1,53-65,105-108| PSIPRED ccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccc //