[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00351.1
DDBJ      :             Oligosaccharide translocase
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  143/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:476 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->269 PF01943 * Polysacc_synt 1e-08 24.4 %
:HMM:PFM   4->268 PF01943 * Polysacc_synt 1.7e-45 24.2 265/273  
:HMM:PFM   192->434 PF03023 * MVIN 2.5e-13 21.5 242/452  
:BLT:SWISS 19->399 RFBX_SHIDY 4e-26 23.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00351.1 GT:GENE ABE00351.1 GT:PRODUCT Oligosaccharide translocase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1626392..1627822) GB:FROM 1626392 GB:TO 1627822 GB:DIRECTION - GB:PRODUCT Oligosaccharide translocase GB:NOTE COG2244 [R] Membrane protein involved in the export of O-antigen and teichoic acid flippase GB:PROTEIN_ID ABE00351.1 GB:DB_XREF GI:90821712 LENGTH 476 SQ:AASEQ MRVIKNYLYNAGYNILALILPLITGPYIGRVLKPEGVGINSYTNSLIQWFVLIAGIGISYYGNREIAYVREDKKKMTQTFWEIQILKVIMTVVAFFLFALFIQFYRKYYWYMILQSLNIVAAAIDISWLYMGIEDFKRTVVRNTMVKLASLAMILIFVRDAGDVGIYIVILALSLIGGNLTLWPHLRVLLVKVSFKELHPLRHFIPTVSLFVPQIATQIYLILNKNMLGIFAGATSAGFYNQSDALVKVILGLVTATGTVMLPHVSNAFAKGETKKVNELLYNSFDFVSCLAIAMMFGLAAVSKYLGTMFYGPGFGPVGLALMIESIVIVLIGWSNVVGTQYLLPTNKVRSFTISVVFGAVVNIVLNFPFIYFWGLYGAVWATVLSELAVTAYQLWVVRHSVDLKKMFENFLKYLVAGILMFIPIYYLELLWKPKDMNVQGIMYTGIEVVIGIIIYVIVLLILKPTILGKIKMIKK GT:EXON 1|1-476:0| BL:SWS:NREP 1 BL:SWS:REP 19->399|RFBX_SHIDY|4e-26|23.4|367/396| TM:NTM 14 TM:REGION 4->26| TM:REGION 42->64| TM:REGION 82->104| TM:REGION 108->130| TM:REGION 139->161| TM:REGION 170->192| TM:REGION 201->223| TM:REGION 245->267| TM:REGION 281->303| TM:REGION 319->341| TM:REGION 350->372| TM:REGION 376->398| TM:REGION 410->432| TM:REGION 444->466| SEG 447->463|ievvigiiiyvivllil| RP:PFM:NREP 1 RP:PFM:REP 4->269|PF01943|1e-08|24.4|266/274|Polysacc_synt| HM:PFM:NREP 2 HM:PFM:REP 4->268|PF01943|1.7e-45|24.2|265/273|Polysacc_synt| HM:PFM:REP 192->434|PF03023|2.5e-13|21.5|242/452|MVIN| GO:PFM:NREP 2 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF01943|IPR002797| GO:PFM GO:0016020|"GO:membrane"|PF01943|IPR002797| OP:NHOMO 201 OP:NHOMOORG 155 OP:PATTERN -----------------------1--------143---1-----------1-1-112-12-------- 1-----------------------------------------------------------------------222-----11-----1-1---3--1--------1------------------------11--1---------------------------------------------------------2-11111-12-1-1--11-1111-12-21-----------1-11111111111111------314124123223112-221-11-11111--1----11121121121-------------1----1-------22-------2-2-----112--1-1-12-----1------------------1----------------------------------------------------------------------------------------------------------------------1-------211111-----1121------111--1----------------------------------1------------------------------1--------------------------------1---------1----------------1------------------11--1--11-11-----11-----------1-----------------------------11-------------------------------------1-1-1-------------------------------------------------1--------------------------------1111------------------------------------1-------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 270-274,476-477| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHEEEEHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcc //