[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00356.1
DDBJ      :             Phosphotyrosine-protein phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  160/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.9c.6.3
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->225 2wjeA PDBj 2e-19 29.9 %
:RPS:PDB   4->220 2anuC PDBj 8e-14 13.3 %
:RPS:SCOP  7->162 1un7A2  c.1.9.10 * 3e-06 19.5 %
:HMM:SCOP  5->248 2anuA1 c.6.3.1 * 7.5e-12 20.7 %
:HMM:PFM   7->146 PF02811 * PHP 8.8e-06 27.9 122/175  
:BLT:SWISS 6->258 YWQE_BACSU 2e-51 40.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00356.1 GT:GENE ABE00356.1 GT:PRODUCT Phosphotyrosine-protein phosphatase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1631759..1632535) GB:FROM 1631759 GB:TO 1632535 GB:DIRECTION - GB:PRODUCT Phosphotyrosine-protein phosphatase GB:NOTE COG3944 [M] Capsular polysaccharide biosynthesis protein capsular polysaccharide biosynthesis GB:PROTEIN_ID ABE00356.1 GB:DB_XREF GI:90821717 LENGTH 258 SQ:AASEQ MNFEKIVDLHCHILPGIDDGSPDLEHSLQLAQEAVADGVTHILATPHHLDRNYTNHAKDVIRIADEFQAELDKREIKLTVFPSQEVHINGELLNRYDDLLGIDEDKRYMLLEFPHDGVPRYAENMIFNLKKMGTIPVIVHPERNHEIQNNLNMLYDFIKAGALAQVTATSYVGGFGSHVAEISHTLVEHNLVQIVASDAHTLKGRKFVLSEALNQIAKDFGEQKAIQFEKNAENLINGEYVVARDYTPIQKKKKFWFF GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 6->258|YWQE_BACSU|2e-51|40.5|252/254| BL:PDB:NREP 1 BL:PDB:REP 6->225|2wjeA|2e-19|29.9|214/244| RP:PDB:NREP 1 RP:PDB:REP 4->220|2anuC|8e-14|13.3|195/218| HM:PFM:NREP 1 HM:PFM:REP 7->146|PF02811|8.8e-06|27.9|122/175|PHP| RP:SCP:NREP 1 RP:SCP:REP 7->162|1un7A2|3e-06|19.5|149/301|c.1.9.10| HM:SCP:REP 5->248|2anuA1|7.5e-12|20.7|208/0|c.6.3.1|1/1|PHP domain-like| OP:NHOMO 183 OP:NHOMOORG 161 OP:PATTERN -------------------------------------------------------------------- 111-----------------------------------------------------------------------------11---------1-311-----1111111-1-----------------1----------------11--------------------1--------------------------1-----11--11-1111111-1111-111111-------11222222222222223--11-1-11111111121111-11111---111----1--1-111111111-------------1111111111---211111111-11----11111-211-11-1--11----1-111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1---1-11-1--------1-1---12-----1--1------------------------11----1----11-------1---------------1---------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1-----------------1--------------------------11---------1 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 86.4 SQ:SECSTR ###EEEEEEEEccTTcTTTccccHHHHHHHHHHHHHTTccEEEEccEEEcHHHHHHHHHTTcccccccGGGHHHHHHHHHHHHHHHHHHHcEEEEEEEEEETTTEEEEEEcccccccTTccHHHHHHHHHHTTcEEEEcccccccccHHHHcTTTTTTccEEEEEEEEETccEEETTEEcHHHHHHHHTTccEEEEcccccGGGGcGGGccEEEEEEEcccHHHHH################################ DISOP:02AL 1-2,245-248| PSIPRED ccHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccEEEcccEEEEcHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEccHHHHHHHHcHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccEEccccccc //