[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00357.1
DDBJ      :             Tyrosine-protein kinase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  499/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->222 3bfvA PDBj 7e-36 38.1 %
:RPS:PDB   21->225 3bfvA PDBj 7e-24 38.7 %
:RPS:SCOP  52->229 1g3qA  c.37.1.10 * 1e-21 23.3 %
:HMM:SCOP  50->232 1ionA_ c.37.1.10 * 3.5e-42 33.9 %
:RPS:PFM   56->225 PF01656 * CbiA 4e-16 38.8 %
:HMM:PFM   56->227 PF01656 * CbiA 8e-17 31.2 141/194  
:BLT:SWISS 3->210 YVEL_BACSU 3e-44 45.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00357.1 GT:GENE ABE00357.1 GT:PRODUCT Tyrosine-protein kinase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1632887..1633612) GB:FROM 1632887 GB:TO 1633612 GB:DIRECTION - GB:PRODUCT Tyrosine-protein kinase GB:NOTE COG0455 [D] ATPases involved in chromosome partitioning capsular polysaccharide biosynthesis GB:PROTEIN_ID ABE00357.1 GB:DB_XREF GI:90821718 LENGTH 241 SQ:AASEQ MALFKKKKKLDTNSMEKGVYLVTIAKPTSVDTEQFNTIRTNITFSSADTEYKSLMITSSVASEGKSTTAANIAASFAKQGLSTLLVDTDLRRPTIAATFGIADPRGLTNFLTDRDFDINDVIYETTVDNLFVIPAGPIPPNPSELMGSRRMDKLREALEEKLDLVIYDAPPVLSVTDAQLLSAKVDGTLLIVRQGFAEKEGVRQAVDLLKHVNAHIIGVVLNDVDASTDGYYGYYGYGKEK GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 3->210|YVEL_BACSU|3e-44|45.3|201/227| SEG 230->238|gyygyygyg| BL:PDB:NREP 1 BL:PDB:REP 12->222|3bfvA|7e-36|38.1|210/241| RP:PDB:NREP 1 RP:PDB:REP 21->225|3bfvA|7e-24|38.7|204/241| RP:PFM:NREP 1 RP:PFM:REP 56->225|PF01656|4e-16|38.8|152/178|CbiA| HM:PFM:NREP 1 HM:PFM:REP 56->227|PF01656|8e-17|31.2|141/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 52->229|1g3qA|1e-21|23.3|176/237|c.37.1.10| HM:SCP:REP 50->232|1ionA_|3.5e-42|33.9|180/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 857 OP:NHOMOORG 507 OP:PATTERN ---------------------------------1---1------------111--------------- 344----111--1--11----1----------1111-221-11112111331222-1-----1-1------11111-1-1313-----1154-611---4-1222332-1-----------------11121112132233---2-7225223-------1--12147772--------1---1111----113111113311331333222213334221221-111111252222222222222221--11-2-2-12122212--12131111---111----1--1-111111111-------------1111111111--1311111111-111---12211-311-11-1--212-22--1111---1-21111-----511321-11---1--------------2--3-21-2-13313222221--121112-33332-1---------21--122------------------------------2242-1----4223451111122773333134483232----132-1--2113-1132111---------222221-1211-31--1111-111-2132112412122-----------------------111-1-12112-311------1--------1------2211------11-1-212221211122-22221212122112222211112111-1111111111111111212121221----------1---------------3131----12-11---12-1111111111112----1-21-11112111----------12211111122122----------------21----------------1--------------------------11-------142 ---------------1---------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 90.5 SQ:SECSTR ###########TTTTccccccHHHHcTTcHHHHHHHHHHHHHHHccTTccccEEEEEcccTTccHHHHHHHHHHHHHHTTccEEEEEcccccccHHHHTTccccccHHHHHTTGcccHHHHEEEcccTTEEEEccccccccHHHHHTcHHHHHHHHHHHHHccEEEEEcccTTTccHHHHHHHHHcEEEEEEETTcccHHHHHHHHHHHHTTTcEEEEEEEEEEcccTc############ DISOP:02AL 1-20,240-242| PSIPRED ccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHccccccccHHHHHHcccccHHHHHcccccccEEEEEcccccccHHHHHcHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccc //