[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00366.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->36 PF06115 * DUF956 0.0004 29.6 27/118  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00366.1 GT:GENE ABE00366.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1644411..1644536) GB:FROM 1644411 GB:TO 1644536 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00366.1 GB:DB_XREF GI:90821727 LENGTH 41 SQ:AASEQ MTKNQKNLVVFYLKSNPNPQILKWIKEKFGEENVINLGAEK GT:EXON 1|1-41:0| HM:PFM:NREP 1 HM:PFM:REP 10->36|PF06115|0.0004|29.6|27/118|DUF956| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,39-42| PSIPRED ccccccEEEEEEEcccccHHHHHHHHHHHccccEEcccccc //