[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00383.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->48 PF07543 * PGA2 0.00022 37.0 27/141  
:HMM:PFM   5->26 PF11137 * DUF2909 0.00063 31.8 22/63  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00383.1 GT:GENE ABE00383.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1662840..1663004 GB:FROM 1662840 GB:TO 1663004 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00383.1 GB:DB_XREF GI:90821744 LENGTH 54 SQ:AASEQ MNGKTLRLLFSVGIMAFVLFSGYLGEYDAKKYIDIILLIIALLIIPRPKLSFRL GT:EXON 1|1-54:0| TM:NTM 2 TM:REGION 3->25| TM:REGION 32->47| SEG 33->45|idiilliiallii| HM:PFM:NREP 2 HM:PFM:REP 21->48|PF07543|0.00022|37.0|27/141|PGA2| HM:PFM:REP 5->26|PF11137|0.00063|31.8|22/63|DUF2909| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccc //