[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00388.1
DDBJ      :             Hypothetical membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->169 PF07155 * DUF1393 6.8e-12 21.7 157/169  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00388.1 GT:GENE ABE00388.1 GT:PRODUCT Hypothetical membrane spanning protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1665947..1666489) GB:FROM 1665947 GB:TO 1666489 GB:DIRECTION - GB:PRODUCT Hypothetical membrane spanning protein GB:PROTEIN_ID ABE00388.1 GB:DB_XREF GI:90821749 LENGTH 180 SQ:AASEQ MTLLSWKSPKLTARTIAMAAILIAMQIVLSKLSIGPDNLVKFSFGFIATMLMGYYLGPWLTGVAMAISDILTNSVFSTGGNFFIGFTFSAIISGIIAGAFLYNQEITLRRLFIYEFVQTLVTNIFFTTLWIHIMYKAPIMALLTVRVPKNILTWIVYSIVGFLVLRAVSRLNLRSNNNTY GT:EXON 1|1-180:0| TM:NTM 4 TM:REGION 22->44| TM:REGION 70->92| TM:REGION 120->142| TM:REGION 151->173| SEG 11->25|ltartiamaailiam| SEG 82->100|ffigftfsaiisgiiagaf| HM:PFM:NREP 1 HM:PFM:REP 10->169|PF07155|6.8e-12|21.7|157/169|DUF1393| OP:NHOMO 16 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2112-111--1111-1----------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-4,6-7,175-181| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //