[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00392.1
DDBJ      :             Hypothetical exported protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:293 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->76 PF10500 * SR-25 0.00029 42.6 54/225  
:HMM:PFM   1->22 PF08085 * Entericidin 0.00081 42.9 21/42  
:BLT:SWISS 97->168 SYR_YERPY 2e-04 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00392.1 GT:GENE ABE00392.1 GT:PRODUCT Hypothetical exported protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1669293..1670174) GB:FROM 1669293 GB:TO 1670174 GB:DIRECTION - GB:PRODUCT Hypothetical exported protein GB:PROTEIN_ID ABE00392.1 GB:DB_XREF GI:90821753 LENGTH 293 SQ:AASEQ MKKSIKIFMATLVALTLAACGNENNKKSSSSETKTTQKSDVSKKSEKTEQSSESSSSSSSSSSESSSSEVSSSSQSGPQQAKVTGDNNTQRMAQIAGALKYFLGKDALVPTKAGISSGVVNAYYTGDGNNFTVYYIKDTEGKNFNDPSLKDKVSYITFSKKTYGSEEEAEQAVNYISGESEMGLPKVPLSGNVNATLNSGAGQRYLHWNSGKWSVTIHGSSVTGKDPVPTGRKVVALLNKAYLPAPDSRGAASFTAGSGSGNQKIEWNSGKAVYTIKGSNINSLIELAGSIQK GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 97->168|SYR_YERPY|2e-04|33.3|72/576| SEG 22->36|nennkkssssetktt| SEG 41->76|vskksekteqssessssssssssessssevssssqs| SEG 248->261|srgaasftagsgsg| HM:PFM:NREP 2 HM:PFM:REP 23->76|PF10500|0.00029|42.6|54/225|SR-25| HM:PFM:REP 1->22|PF08085|0.00081|42.9|21/42|Entericidin| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111----11---1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,21-86,292-294| PSIPRED cccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHccccccccccccEEccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccccEEEEEEEccccccccccccccccEEEEEEEEccccHHHHHHHcccccccccccccEEEccccEEEEEEccccEEEEEEEcccEEEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccEEEccccccccEEEEEccEEEEEEEcccHHHHHHHHHHHcc //