[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00402.1
DDBJ      :             L-2-hydroxyisocaproate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  483/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.162.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->301 1hyhC PDBj 5e-75 51.0 %
:RPS:PDB   5->302 2d4aD PDBj 1e-66 27.1 %
:RPS:SCOP  3->143 1emdA1  c.2.1.5 * 9e-21 19.6 %
:RPS:SCOP  145->272 1ojsA2  d.162.1.1 * 4e-34 26.3 %
:HMM:SCOP  1->145 1ldnA1 c.2.1.5 * 1.2e-37 38.5 %
:HMM:SCOP  144->303 2ldxA2 d.162.1.1 * 1e-44 40.0 %
:RPS:PFM   2->143 PF00056 * Ldh_1_N 1e-15 32.1 %
:RPS:PFM   146->299 PF02866 * Ldh_1_C 3e-13 32.5 %
:HMM:PFM   146->299 PF02866 * Ldh_1_C 9.8e-32 32.5 154/174  
:HMM:PFM   3->143 PF00056 * Ldh_1_N 1.5e-23 29.0 138/142  
:BLT:SWISS 2->301 DHL2_LACCO 4e-74 51.0 %
:PROS 173->179|PS00064|L_LDH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00402.1 GT:GENE ABE00402.1 GT:PRODUCT L-2-hydroxyisocaproate dehydrogenase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1679556..1680464) GB:FROM 1679556 GB:TO 1680464 GB:DIRECTION - GB:PRODUCT L-2-hydroxyisocaproate dehydrogenase GB:NOTE COG0039 [C] Malate/lactate dehydrogenases GB:PROTEIN_ID ABE00402.1 GB:DB_XREF GI:90821763 LENGTH 302 SQ:AASEQ MRKMAVIGLGHVGATVAYTLVSQGIADELVLIDTNEKKVVAEKLDFEDAMPRLPYHVEIKTQDYAELKDVDVIITAFGDIDASVRTGNRFAEFEINTKNAVEVGKKIKESGFSGVIIDISNPCDAVTSILQETTGLPRNQVLGTGTFLDTARMQHVVGDALGQDGRNVEGFVLGEHGNSQFVAWSTVRVNNKPITEFFTEEELEELGKKPAEGGFKVANGKGYTSYAIATCGVKLAQAVLSNAHFFGPVSTYVEEVGTYVGYPAIVGAKGVEKVVSLVLTDEEKAKLEQSANYIKEHLDSLK GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 2->301|DHL2_LACCO|4e-74|51.0|300/310| PROS 173->179|PS00064|L_LDH|PDOC00062| SEG 195->206|teffteeeleel| BL:PDB:NREP 1 BL:PDB:REP 2->301|1hyhC|5e-75|51.0|292/297| RP:PDB:NREP 1 RP:PDB:REP 5->302|2d4aD|1e-66|27.1|295/308| RP:PFM:NREP 2 RP:PFM:REP 2->143|PF00056|1e-15|32.1|140/141|Ldh_1_N| RP:PFM:REP 146->299|PF02866|3e-13|32.5|154/169|Ldh_1_C| HM:PFM:NREP 2 HM:PFM:REP 146->299|PF02866|9.8e-32|32.5|154/174|Ldh_1_C| HM:PFM:REP 3->143|PF00056|1.5e-23|29.0|138/142|Ldh_1_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00056|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00056|IPR001236| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02866|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02866|IPR001236| RP:SCP:NREP 2 RP:SCP:REP 3->143|1emdA1|9e-21|19.6|138/145|c.2.1.5| RP:SCP:REP 145->272|1ojsA2|4e-34|26.3|118/152|d.162.1.1| HM:SCP:REP 1->145|1ldnA1|1.2e-37|38.5|143/0|c.2.1.5|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 144->303|2ldxA2|1e-44|40.0|160/0|d.162.1.1|1/1|LDH C-terminal domain-like| OP:NHOMO 1117 OP:NHOMOORG 634 OP:PATTERN 11-1--1111111111-111111111111111-111111111-22222--1111------1111--12 121--12111112--------1----------1111-1--1--1-1--1-----111---11-3---1---12222221-2--21111111111-----11111111121---------------111111111212221111111222-11211--------11-2112-------------1-11111-2224444444444444442222224442222223444444223222222222222213221323123325333556633222113344222111121111111111111111111111111111122211111--241111111212211111112122-1112211-22-1--111-1-1-123111-11111111111111211111111111111-11-111111111111211111111111111111111111------------11211111111111111111111111111111111111----------------------------------------1-----------1--------------------1-1-------11--121111111222212--1111-222221-1-------11112----1------------------------------1--2------11---1-------------------------------111--------------------------------------------------------------------------------------------1----111-----111111111-----------1-11-----------------1------111111111-1----1-1111-11111111111---1111-1111111- 3222--1-3-----1--2211-1-1-1----------------------111-7-1112111-----3-----------------------------------121-1---2734454321541582K2EY6-76B22329248514243333E2433211231-21231911-15---------3232112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 100.0 SQ:SECSTR ccEEEEEcccHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHTccccEEEccGGGGTTccEEEEcccccccTTcTccHHHcHHHHHHHHHHHHHHHHHHcTTcEEEEccccHHHHHHHHHHHHcccGGGEEEccHHHHHHHHHHHHHHHHTccGGGEEccEEccccTTcEEcGGGcEETTEETTTTccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHTccEEEEEEEEEEcEEEEEEEEEEEETTEEEEEccccccHHHHHHHHHHHHHHHHHHTTcc DISOP:02AL 84-84| PSIPRED cEEEEEEcccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHccccccEEEcccHHHHccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccHHHEEEEccHHHHHHHHHHHHHHHcccHHHcEEEEEccccccEEEEHHHcEEccEEHHHHHcHHHHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHc //