[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00411.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   65->109 PF01446 * Rep_1 2.9e-05 22.2 45/233  
:HMM:PFM   33->80 PF08393 * DHC_N2 0.00014 16.7 48/408  
:HMM:PFM   9->56 PF02840 * Prp18 0.00058 20.8 48/145  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00411.1 GT:GENE ABE00411.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1695311..1695679 GB:FROM 1695311 GB:TO 1695679 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00411.1 GB:DB_XREF GI:90821772 LENGTH 122 SQ:AASEQ MQPKKRYVQPQTVREAMETIQKLFNSYRHAPLTQDLLNYHINLTNRLQTDIYVAALREKNDKQLEDLKAMTEAMQTWTKIRSENKPFIGKMKNFRLTNNNGPKFKQHVHKIKGNHSYRGVKH GT:EXON 1|1-122:0| HM:PFM:NREP 3 HM:PFM:REP 65->109|PF01446|2.9e-05|22.2|45/233|Rep_1| HM:PFM:REP 33->80|PF08393|0.00014|16.7|48/408|DHC_N2| HM:PFM:REP 9->56|PF02840|0.00058|20.8|48/145|Prp18| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11---1111--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,111-123| PSIPRED ccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccHHHHHHHHHHHcccccccccc //