[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00419.1
DDBJ      :             Transcriptional regulator, GntR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  151/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->107 2ek5C PDBj 1e-14 38.5 %
:RPS:PDB   5->118 3by6D PDBj 3e-19 22.3 %
:RPS:SCOP  10->77 1e2xA1  a.4.5.6 * 2e-14 22.1 %
:HMM:SCOP  3->102 1v4rA1 a.4.5.6 * 4.5e-15 27.0 %
:RPS:PFM   15->75 PF00392 * GntR 4e-07 36.1 %
:HMM:PFM   13->75 PF00392 * GntR 1.7e-12 36.5 63/64  
:BLT:SWISS 6->118 YHCF_BACSU 4e-15 29.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00419.1 GT:GENE ABE00419.1 GT:PRODUCT Transcriptional regulator, GntR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1702209..1702577) GB:FROM 1702209 GB:TO 1702577 GB:DIRECTION - GB:PRODUCT Transcriptional regulator, GntR family GB:NOTE COG0640 [K] Predicted transcriptional regulators GB:PROTEIN_ID ABE00419.1 GB:DB_XREF GI:90821780 LENGTH 122 SQ:AASEQ MLHFNFNSTEPIYLQVANQLEEAIFTKAFLDGTQVPSTTEISKEFHINPATVLKGMNILVNDGLLEKRRGLGMFVTEGAYMKLLERRKESFYQDYIVKMIQEAKKLGMNEDDLIELVKRGVD GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 6->118|YHCF_BACSU|4e-15|29.7|111/121| BL:PDB:NREP 1 BL:PDB:REP 11->107|2ek5C|1e-14|38.5|96/117| RP:PDB:NREP 1 RP:PDB:REP 5->118|3by6D|3e-19|22.3|112/121| RP:PFM:NREP 1 RP:PFM:REP 15->75|PF00392|4e-07|36.1|61/64|GntR| HM:PFM:NREP 1 HM:PFM:REP 13->75|PF00392|1.7e-12|36.5|63/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 1 RP:SCP:REP 10->77|1e2xA1|2e-14|22.1|68/73|a.4.5.6| HM:SCP:REP 3->102|1v4rA1|4.5e-15|27.0|100/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 193 OP:NHOMOORG 151 OP:PATTERN -------------------------------------------------------------------- -1--11111111-2----------------------11-1-1-1-1111---11-1-1------11--1-----------11------111--111---------1-1-1------------------------------------------------------------------------------11---21121212212121213411122221---3--111--1-2---------------1----111-11-111-111111-11--------------11----------------------------------121-2222222212-2222-1-132----11--33----11-1---------1-----------------------------------------------------------------------------------------------------------------------1111--111--------------------------------------------------------------------1--------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------111111------------------------------------------------------------------1-----111--1111111111----------------------1---------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 97.5 SQ:SECSTR HHcccccccccHHHHHHHHHHHHHHTTcccTTcEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHH### DISOP:02AL 1-7,81-90| PSIPRED cccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcc //