[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00427.1
DDBJ      :             Amino acid ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:248 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->240 2oukB PDBj 2e-51 46.2 %
:RPS:PDB   1->234 2d3wB PDBj 1e-42 17.0 %
:RPS:SCOP  1->241 1b0uA  c.37.1.12 * 4e-52 37.3 %
:HMM:SCOP  4->226 1ii8.1 c.37.1.12 * 5.5e-70 39.8 %
:RPS:PFM   41->169 PF00005 * ABC_tran 3e-20 50.8 %
:HMM:PFM   41->169 PF00005 * ABC_tran 3.6e-27 38.8 116/118  
:HMM:PFM   16->48 PF03193 * DUF258 2.6e-07 37.5 32/161  
:BLT:SWISS 1->240 TCYC_BACSU 3e-62 47.5 %
:PROS 141->155|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00427.1 GT:GENE ABE00427.1 GT:PRODUCT Amino acid ABC transporter, ATP-binding protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1710089..1710835) GB:FROM 1710089 GB:TO 1710835 GB:DIRECTION - GB:PRODUCT Amino acid ABC transporter, ATP-binding protein GB:NOTE COG1126 [E] ABC-type polar amino acid transport system, ATPase component GB:PROTEIN_ID ABE00427.1 GB:DB_XREF GI:90821788 LENGTH 248 SQ:AASEQ MLRLENVNKTFGGNLALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLLEMPESGKYYFDDLELDFKKGISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRAYELLKKVGLADKADAYPQQLSGGQAQRVAIARSLAMNPRYILLDEPTSALDPELELEVLKVLLQLAKEKQSLIIVTHNLAFAQKVADKILFVEDGQILFQGPKDDFFNSDNQRIKNFLSAMTLSNLD GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 1->240|TCYC_BACSU|3e-62|47.5|240/247| PROS 141->155|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 174->191|elelevlkvllqlakekq| BL:PDB:NREP 1 BL:PDB:REP 1->240|2oukB|2e-51|46.2|236/241| RP:PDB:NREP 1 RP:PDB:REP 1->234|2d3wB|1e-42|17.0|230/244| RP:PFM:NREP 1 RP:PFM:REP 41->169|PF00005|3e-20|50.8|120/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->169|PF00005|3.6e-27|38.8|116/118|ABC_tran| HM:PFM:REP 16->48|PF03193|2.6e-07|37.5|32/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->241|1b0uA|4e-52|37.3|241/258|c.37.1.12| HM:SCP:REP 4->226|1ii8.1|5.5e-70|39.8|221/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 46901 OP:NHOMOORG 1173 OP:PATTERN TTMASHHIUUTRUQXNlHPPNPMVvJNkoUhUIBDDEBHGHFDSZSWnLQ**i8TdQRVLTJJEX18A UclN*ZZahhjUaRXSSML-LfAAW*MMMMMNpjikm***U*X*p*qZpkbP*zuKQd99suyd*mx***cZUTTzaYbN*iiBCDBCRQQH6KEGJ--EHSJLJbNYJP9A99A9ABCCBBBBJTNJQYOLRSXNfppy*LKI*XvjnsedmdhSUJFLGOFbdWh***aLOHLJMJOJLGJgYZQOxoBTZz************************gmw**drwuvqsv**ajkmlmggikjjjhjXdZbfycXZ**XPZVdsrQR**cXQWkjgggnmrqnlturqntoqmmrsmorYZZYZZZabbaXZ*kiYXZljmil*z*********i*nq***cghe*niyy*dnSK**tlZafnTYleokNfYVObURRLJMLJLcX***YSq****************-lp*jf*n***TB**************IIK**********ONOOOOOOxbfIOhR*55455555556788DE88B97988A7595MDCDEE************xxzu********j********BOzzo*kuov******dnmOTKSmUHJJIHIJTQNZnnc**NeUxmVjudbqLcaWVTYgWZaWXZoxX*PLLPHNNNPKHCCCEDDECDHUGGJLLkksMtScKUP*QUXZVNTZWSTRPUYVUZY5-ELSNM32-333****Z*xy***z***xy-*yx**********vvxvuu*****hkjnmjkmnnmmmkknkkl*snpttuvS4************34JGDECDENOQOML*o*bbacWXJQTOOTOTgPRTRRITIQSpZrqrrv***u**tzg***FFEDDEFDFMgro*rrssr*****ONLLJLKFHGCBBB75NUSSJKLLAA8A99A9*BaEBCDD-8FEDHGCPOMBIKCGHBBBclwWUq*rpqEbL 2133PP9-NB39HTJC7FACHJDNBNEDE8A89IHH8IDFEDF889EDGLJGRLGGJ9CDAD94735625535667414455555567-7C476B78888738IEB2BOUULTNdSTD8B7BMGeh6e8**a2XLbGAC5W7EaN7J889S89*DPKHmFZ*AgHN9mMP*PWOHBBB9*7667IXQW*CnZEFaRVU8 ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 248-249| PSIPRED cEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccccccHHHHHHHHHHccEEEEcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccccHHHHHHHccccHHccc //