[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00428.1
DDBJ      :             Amino acid ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  701/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->181 3dhwA PDBj 9e-08 24.5 %
:RPS:PDB   123->164 3dhwA PDBj 3e-08 36.8 %
:RPS:SCOP  16->222 2r6gG1  f.58.1.1 * 1e-24 19.1 %
:HMM:PFM   53->222 PF00528 * BPD_transp_1 1.7e-24 19.1 162/185  
:BLT:SWISS 2->229 TCYB_BACSU 2e-59 53.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00428.1 GT:GENE ABE00428.1 GT:PRODUCT Amino acid ABC transporter, permease protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1710858..1711553) GB:FROM 1710858 GB:TO 1711553 GB:DIRECTION - GB:PRODUCT Amino acid ABC transporter, permease protein GB:NOTE COG0765 [E] ABC-type amino acid transport system, permease component GB:PROTEIN_ID ABE00428.1 GB:DB_XREF GI:90821789 LENGTH 231 SQ:AASEQ MWHTVISSLPELISAGIKYTIPLAIVSFILGLILALVTALIRISQTKGPFLVIKAIFRFYVWLFRSTPLLVQLFIVYFGLPYLKIKGLAPEGIKLDPFTSGIIVFSLNTGAYASETIRAAITSIPKGQWEAAASIGMTHKQALMRIIIPQAARVSLPPLANSFIGLVKDTSLAASITIVEMFEVSQQIAAENYEPLVMYCTVAVLYAILCTVLSFLQGWLEKVTSRYVATQ GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 2->229|TCYB_BACSU|2e-59|53.7|216/234| TM:NTM 4 TM:REGION 20->42| TM:REGION 54->76| TM:REGION 96->118| TM:REGION 196->218| BL:PDB:NREP 1 BL:PDB:REP 12->181|3dhwA|9e-08|24.5|147/203| RP:PDB:NREP 1 RP:PDB:REP 123->164|3dhwA|3e-08|36.8|38/203| HM:PFM:NREP 1 HM:PFM:REP 53->222|PF00528|1.7e-24|19.1|162/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 16->222|2r6gG1|1e-24|19.1|199/284|f.58.1.1| OP:NHOMO 4702 OP:NHOMOORG 735 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----4313333321411----5--1D------666636C914225283533-769135--2221577B5A4755576631431---------------------------11111111111111-----1--4---222441111-2234223332221221--11-3322-2222--2222-1341111--27455555875566556623398556333754355555396222222222222222222246757AB885676666B93757E533388886665AA999898999986666566666666798BA98888135575645455232344423333122142331AA-4132-1111111171--11137444421M68222422222375347567R-22I22E29EK23rUUQUXVWViNOPA---36L868A35E1111111133511-4A----------111111111111111--1-5--21-5HFBHNMMLOKC9DDDFFJVEDEEADHHc77B412B9C95854C9HGNQ244----A44422222---25-11L-897C56CAAA42-23-3-------1--5-4441555554343333333-13----9AC-3-----D-1111--11111111-11-3---1--------BBNN7DEAAAAAA8AA9-AACAAAAAAAAAA9AA99BJPHON776A8A7AAAAAAAAAA8AH99899993-FCCCCCBBCCCC--5-222221111--7AF55553533323333266666-64554-GEEGIQKTBHJDF5NKL----------777A99999AA97711---------------2----------------3628----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 66.7 SQ:SECSTR ###########HHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTccccccccHHHHHHHHHHHccHHH###HHHHHHHHHHHTTcccccHH#####HHHHHHHHHHHHHHHTTcHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHcHHHHHHHHHHHH########HHHHHHHHH################################################## DISOP:02AL 229-232| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //