[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00442.1
DDBJ      :             Transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  257/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->110 1r1vB PDBj 3e-18 46.4 %
:RPS:PDB   38->106 1bibA PDBj 1e-12 18.8 %
:RPS:SCOP  22->113 1r1uA  a.4.5.5 * 5e-18 42.4 %
:HMM:SCOP  9->115 1u2wA1 a.4.5.5 * 7.5e-28 35.5 %
:RPS:PFM   38->83 PF01022 * HTH_5 4e-08 52.2 %
:HMM:PFM   39->83 PF01022 * HTH_5 2.2e-18 57.8 45/47  
:HMM:PFM   12->52 PF12536 * DUF3734 0.00083 24.4 41/108  
:BLT:SWISS 7->115 ZIAR_SYNY3 9e-18 33.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00442.1 GT:GENE ABE00442.1 GT:PRODUCT Transcriptional regulator, ArsR family GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1728560..1728910 GB:FROM 1728560 GB:TO 1728910 GB:DIRECTION + GB:PRODUCT Transcriptional regulator, ArsR family GB:NOTE COG0640 [K] Predicted transcriptional regulators GB:PROTEIN_ID ABE00442.1 GB:DB_XREF GI:90821803 LENGTH 116 SQ:AASEQ MLVMVELVLVNYMKEHFAKLPSEEETQRSVQIFKAFGDYTRYKILYLLYERELSVSEITSEIGVSQSAISHQLKLLRQTGLVSGRRDGQRILYSLADKHIIMIFKQVKEHISEDDI GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 7->115|ZIAR_SYNY3|9e-18|33.9|109/132| BL:PDB:NREP 1 BL:PDB:REP 27->110|1r1vB|3e-18|46.4|84/96| RP:PDB:NREP 1 RP:PDB:REP 38->106|1bibA|1e-12|18.8|69/294| RP:PFM:NREP 1 RP:PFM:REP 38->83|PF01022|4e-08|52.2|46/47|HTH_5| HM:PFM:NREP 2 HM:PFM:REP 39->83|PF01022|2.2e-18|57.8|45/47|HTH_5| HM:PFM:REP 12->52|PF12536|0.00083|24.4|41/108|DUF3734| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 22->113|1r1uA|5e-18|42.4|92/94|a.4.5.5| HM:SCP:REP 9->115|1u2wA1|7.5e-28|35.5|107/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 392 OP:NHOMOORG 282 OP:PATTERN -------111111111----------------11111-1---1---1111211-1------------1 -1--1---------21122-2---1-22222-21112114---1--------1-2--111-1--111-231-------11112---------------------1---1-----------------1-2121---1-11--111--1111111--11------111122---------------1111---131222221241222213212211221463211111111133-11121111111111111111-211211111111-2211-111-----------------------------------------------214111111111212123312222-2113112-64123121213112-111---------------------------------------------------1-1--1-------1------------------------1-----------------------------------------------------------------------------11---------1---1-------------1-11-1211--1221------1--1-------11---1----------------1----111---------1----------11----1-------1----------1---------------------------------------1---------------------------------------------------11--1---------------------1-------------------------------1----1-11---1------1---------11-1--------------1-2-------------------------2-121-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 87.1 SQ:SECSTR ###############ccTETTccEEEEccHHHHHHHTcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccHHH DISOP:02AL 1-4,11-26,115-117| PSIPRED ccccHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHccc //