[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00449.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  240/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.7
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   125->253 3gkuB PDBj 1e-21 46.4 %
:RPS:PDB   186->258 2cpmA PDBj 9e-11 16.7 %
:RPS:SCOP  196->254 1mszA  d.68.7.1 * 4e-08 13.8 %
:HMM:SCOP  188->256 1mszA_ d.68.7.1 * 4.4e-08 29.0 %
:RPS:PFM   214->255 PF01424 * R3H 7e-04 46.3 %
:HMM:PFM   210->254 PF01424 * R3H 2.5e-12 31.8 44/55  
:HMM:PFM   78->139 PF01888 * CbiD 0.00024 24.6 61/261  
:HMM:PFM   136->226 PF09665 * RE_Alw26IDE 0.00093 21.1 90/511  
:BLT:SWISS 6->253 JAG_BACSU 2e-29 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00449.1 GT:GENE ABE00449.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION complement(1733912..1734691) GB:FROM 1733912 GB:TO 1734691 GB:DIRECTION - GB:PRODUCT Hypothetical protein GB:NOTE COG1491 [J] Predicted RNA-binding protein GB:PROTEIN_ID ABE00449.1 GB:DB_XREF GI:90821810 LENGTH 259 SQ:AASEQ MMQYTGETIDSAISKGLQDLSVDRENVEIEVISHGRKGFLGLGKKPAVIELTVNSSVQTESDTKPQLEIVSEDQVDRESETLDNEDSKNIEINSEKVEEENQNNLDVVIQNLGYYLADITKQLGIEAVIDVSQGKKVVYYNFDTELEGLLIGKHGRTLNSLQLLAQDYFDKHKNNNRRIRIMLNVADYRERREETLNNLAQKKAHEAIISRSQISLEPMPAFERKIIHSSLAKDEHVKTFSRGSEPYRYVIIAPAKAKY GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 6->253|JAG_BACSU|2e-29|40.0|195/208| BL:PDB:NREP 1 BL:PDB:REP 125->253|3gkuB|1e-21|46.4|125/187| RP:PDB:NREP 1 RP:PDB:REP 186->258|2cpmA|9e-11|16.7|72/94| RP:PFM:NREP 1 RP:PFM:REP 214->255|PF01424|7e-04|46.3|41/56|R3H| HM:PFM:NREP 3 HM:PFM:REP 210->254|PF01424|2.5e-12|31.8|44/55|R3H| HM:PFM:REP 78->139|PF01888|0.00024|24.6|61/261|CbiD| HM:PFM:REP 136->226|PF09665|0.00093|21.1|90/511|RE_Alw26IDE| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01424|IPR001374| RP:SCP:NREP 1 RP:SCP:REP 196->254|1mszA|4e-08|13.8|58/62|d.68.7.1| HM:SCP:REP 188->256|1mszA_|4.4e-08|29.0|62/0|d.68.7.1|1/1|R3H domain| OP:NHOMO 240 OP:NHOMOORG 240 OP:PATTERN -------------------------------------------------------------------- ---1------------------1111-----11---1111---11---1-------1-----1-11-11111111---1111------------------------------------------------------11111111111---------------------1--------------111--11-11111111111111111111111111111111--111111111-------------------1-1-11-1---11111111----1111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111---------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111-------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 51.4 SQ:SECSTR ############################################################################################################################HHHHHHHTccccEEEEE#TTTTEGGGTTTHHHHHHHHHHHHHTTHHHHHTcccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHTcEEEEEcccccccEEEEEccTT# DISOP:02AL 58-83,85-85,258-260| PSIPRED cEEEEcccHHHHHHHHHHHccccEEEEEEEEEEEccccccccccccEEEEEEEEccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEccHHHHHHHccccccHHHHHHHHHHHHHHHcccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEEcccc //