[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00458.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   74->119 PF02889 * Sec63 0.00027 34.1 44/312  
:BLT:SWISS 4->62 PDE4_CAEEL 1e-05 39.7 %
:BLT:SWISS 41->114 SNX41_YEAST 2e-04 25.7 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00458.1 GT:GENE ABE00458.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1740027..1740452 GB:FROM 1740027 GB:TO 1740452 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABE00458.1 GB:DB_XREF GI:90821819 LENGTH 141 SQ:AASEQ MQAMKKHAKLLNDLNNFIEIKRILADNVKTLDKISDDIDQQEKEIERLEQLNTPTFQIKQMQDNHDIKATSYNLLLELHQHNLITLWKLSRYILKQFKHFSEDEIKEYKLNDIQESIQEQSDNIKPKFIDLLKYDIKHIKD GT:EXON 1|1-141:0| BL:SWS:NREP 2 BL:SWS:REP 4->62|PDE4_CAEEL|1e-05|39.7|58/674| BL:SWS:REP 41->114|SNX41_YEAST|2e-04|25.7|74/625| COIL:NAA 26 COIL:NSEG 1 COIL:REGION 24->49| HM:PFM:NREP 1 HM:PFM:REP 74->119|PF02889|0.00027|34.1|44/312|Sec63| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,118-122,140-142| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcc //