[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00459.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
d.264.1
:256 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  3->114 1rniA  d.264.1.2 * 9e-12 24.5 %
:HMM:SCOP  1->187 1ro2A_ d.264.1.2 * 1.1e-21 27.6 %
:RPS:PFM   13->155 PF09250 * Prim-Pol 3e-18 37.6 %
:RPS:PFM   194->251 PF08708 * PriCT_1 4e-04 33.3 %
:HMM:PFM   10->157 PF09250 * Prim-Pol 1.1e-31 35.9 145/162  
:HMM:PFM   191->253 PF08708 * PriCT_1 4.8e-16 27.4 62/72  
:BLT:SWISS 56->152 HUTI_PSEF5 3e-05 26.6 %
:BLT:SWISS 129->210 XYNA_PENCH 4e-04 30.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00459.1 GT:GENE ABE00459.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1740458..1741228 GB:FROM 1740458 GB:TO 1741228 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABE00459.1 GB:DB_XREF GI:90821820 LENGTH 256 SQ:AASEQ MNRLDQVIEMVQRGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLAKSNLIIVDIDNHNNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTKFIDGVDLLSDFVVTSPSTNYKILNGATLDDIPQTPNWIIKALDNRAMPTDKMQDNPTPYRRYYTGYLIDEIVNGVDAGNRNNWIASIFGKLLRAGASPKNAYSLLQLINDNYVQPPLPAKELDNVAESILKRFINE GT:EXON 1|1-256:0| BL:SWS:NREP 2 BL:SWS:REP 56->152|HUTI_PSEF5|3e-05|26.6|94/401| BL:SWS:REP 129->210|XYNA_PENCH|4e-04|30.9|81/100| RP:PFM:NREP 2 RP:PFM:REP 13->155|PF09250|3e-18|37.6|141/163|Prim-Pol| RP:PFM:REP 194->251|PF08708|4e-04|33.3|57/66|PriCT_1| HM:PFM:NREP 2 HM:PFM:REP 10->157|PF09250|1.1e-31|35.9|145/162|Prim-Pol| HM:PFM:REP 191->253|PF08708|4.8e-16|27.4|62/72|PriCT_1| RP:SCP:NREP 1 RP:SCP:REP 3->114|1rniA|9e-12|24.5|106/210|d.264.1.2| HM:SCP:REP 1->187|1ro2A_|1.1e-21|27.6|185/210|d.264.1.2|1/1|Prim-pol domain| OP:NHOMO 44 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1---22--1212-1--113-----------------------21---22-1------------1------------------------7--------------------------------------------------------------------1--------------------------------------------1-------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------1-------------------------------------------1111------------------------------------------ DISOP:02AL 1-1,167-181,255-257| PSIPRED ccHHHHHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHHHcccccEEEEcccccEEEEEEEccccHHHHHHHHHHHccccccccEEEEcccccEEEEEEccccccccccccccccEEEcccEEEccccccEEEcccccccccccccHHHHHHHHcccccHHHcccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcc //