[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00463.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->70 PF00482 * GSPII_F 0.00098 31.7 41/124  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00463.1 GT:GENE ABE00463.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1743744..1743959 GB:FROM 1743744 GB:TO 1743959 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABE00463.1 GB:DB_XREF GI:90821824 LENGTH 71 SQ:AASEQ MDKEKELRKYNNMIINDKLDYIIKQNKNLESLSNRNTEMILKRLERIQKLNQTIIYLLLGVVGLLITILLG GT:EXON 1|1-71:0| TM:NTM 1 TM:REGION 49->71| SEG 53->70|tiiylllgvvgllitill| HM:PFM:NREP 1 HM:PFM:REP 30->70|PF00482|0.00098|31.7|41/124|GSPII_F| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHccHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //