[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00468.1
DDBJ      :             Hypothetical protein, phage associated
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->35 PF10002 * DUF2243 0.00022 42.3 26/144  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00468.1 GT:GENE ABE00468.1 GT:PRODUCT Hypothetical protein, phage associated GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1744651..1744902 GB:FROM 1744651 GB:TO 1744902 GB:DIRECTION + GB:PRODUCT Hypothetical protein, phage associated GB:PROTEIN_ID ABE00468.1 GB:DB_XREF GI:90821829 LENGTH 83 SQ:AASEQ MVACFFIASDTPLLHQLIQLHSLLDLQTLRINMTDTVNDLIYRIVAIQSKTKKPRYKHRSSMTKDNINRFIKIIKFGVVLILE GT:EXON 1|1-83:0| SEG 13->29|llhqliqlhslldlqtl| HM:PFM:NREP 1 HM:PFM:REP 10->35|PF10002|0.00022|42.3|26/144|DUF2243| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 51-63| PSIPRED cEEEEEEEcccHHHHHHHHHHHHHcHHEEEEEcHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHEEEEEc //