[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00472.1
DDBJ      :             D-alanine aminotransferase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  482/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:281 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->273 1daaA PDBj 6e-47 36.3 %
:RPS:PDB   4->270 1a0gB PDBj 3e-62 34.8 %
:RPS:SCOP  6->273 1a0gA  e.17.1.1 * 2e-67 35.8 %
:HMM:SCOP  3->275 1daaA_ e.17.1.1 * 4e-72 32.2 %
:RPS:PFM   44->266 PF01063 * Aminotran_4 4e-20 35.7 %
:HMM:PFM   44->269 PF01063 * Aminotran_4 7.2e-38 32.1 221/232  
:BLT:SWISS 8->260 DAAA_LISMF 1e-48 40.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00472.1 GT:GENE ABE00472.1 GT:PRODUCT D-alanine aminotransferase GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1750082..1750927 GB:FROM 1750082 GB:TO 1750927 GB:DIRECTION + GB:PRODUCT D-alanine aminotransferase GB:NOTE COG0115 [EH] Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase GB:PROTEIN_ID ABE00472.1 GB:DB_XREF GI:90821833 LENGTH 281 SQ:AASEQ MKQVGYYNGTIADLNELKVPATDRALYFGDGCYDATTFKNNVAFALEDHLDRFYNSCRLLEIDFPLNRDELKEKLYAVIDANEVDTGILYWQTSRGSGLRNHIFPEDSQPNLLIFTAPYGLVPFDTEYKLISREDTRFLHCNIKTLNLLPNVIASQKANESHCQEVVFHRGDRVTECAHSNILILKDGVLCSPPRDNLILPGITLKHLLQLAKENNIPTSEAPFTMDDLRNADEVIVSSSACLGIRAVELDGQPVGGKDGKTLKILQDAYAKKYNAETVSR GT:EXON 1|1-281:0| BL:SWS:NREP 1 BL:SWS:REP 8->260|DAAA_LISMF|1e-48|40.9|252/289| BL:PDB:NREP 1 BL:PDB:REP 7->273|1daaA|6e-47|36.3|267/277| RP:PDB:NREP 1 RP:PDB:REP 4->270|1a0gB|3e-62|34.8|267/282| RP:PFM:NREP 1 RP:PFM:REP 44->266|PF01063|4e-20|35.7|210/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 44->269|PF01063|7.2e-38|32.1|221/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 6->273|1a0gA|2e-67|35.8|268/280|e.17.1.1| HM:SCP:REP 3->275|1daaA_|4e-72|32.2|273/277|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 773 OP:NHOMOORG 533 OP:PATTERN ------------------111--111121122---1111111111111111111-----------1-1 1-11--------------------------------1-----------------------------1111----------1-1--222-------------12-11-121---------------1111111111-1--1---11-31-111-11111-11-11121----11-1---1-1-------11-22255555555455555522332255533311111111112--1111111111111111111------------------1---------------------------------------------------11-11---------1-1--411--1---2--12221-1111221111---1211111-----1211-1111111111111111113-11111111222-32212121313322-33212212211111111111111-1-11------------------------------1---11333213323112222111-2222222212112--11122111-22421111222211-------1111221-1-13222132221-------1-1212-1-1-1111-----1----------11--111121122-1-1-------1----1-11-11---3322------12341111111111111-1111111111111111111111222221111111111111111111111111-111111111111-1-1111112222123-1---------------------1111212222111121111111111---11-12-1211111111111--------------12--11-----------------------------------------2--------111 ---------------1-------1-11---------------------111122----------------------------------------------1------------------------------------------------------------------------1---1-------2123-3-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 98.9 SQ:SECSTR cccEEEETTEEEEGGGccccTTcHHHHTccEEEEEEEEETTEETTHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHTcccEEEEEEEEccccccccccccTTcccEEEEEEEEccccHHHHHHcEEEEccccccTTccccccHHHHHHHHHHHHTTccEEEEEETTEEEEEcccEEEEEETTEEEEccccTTccccHHHHHHHHHHHHTTccEEcccccHHHHTTccEEEEEETTTEEEEEEEETTEEcTccccHHHHHHHHHHHTTGTTcc### DISOP:02AL 277-282| PSIPRED ccEEEEEccEEccHHHcccccccHHHHHccEEEEEEEEEccEEccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccEEEEEEEEEEccccccccccccccEEEEEEEEcccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccEEEEccEEEEEEEccEEEEccccccEEccHHHHHHHHHHHHcccEEEEEEccHHHHHcccEEEEEccccEEEEEEEEccEEEcccccHHHHHHHHHHHHHHccccccc //