[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Lactobacillus salivarius UCC118 (lsal0)
Gene : ABE00480.1
DDBJ      :             Hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   53->95 2djpA PDBj 1e-04 14.0 %
:HMM:PFM   73->95 PF01476 * LysM 8.8e-06 34.8 23/44  
:HMM:PFM   2->72 PF02635 * DrsE 0.00096 35.1 57/119  
:BLT:SWISS 68->95 YOCH_BACSU 4e-04 46.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE00480.1 GT:GENE ABE00480.1 GT:PRODUCT Hypothetical protein GT:DATABASE GIB00337CH01 GT:ORG lsal0 GB:ACCESSION GIB00337CH01 GB:LOCATION 1759530..1759820 GB:FROM 1759530 GB:TO 1759820 GB:DIRECTION + GB:PRODUCT Hypothetical protein GB:PROTEIN_ID ABE00480.1 GB:DB_XREF GI:90821841 LENGTH 96 SQ:AASEQ MEKLYKALTEQKYRVKLIKKGNHWVARGMTILLFGLGVIALSNVEVQASSWHANSPAEIAKRISSNDRTFTFERGDTFWGISQVLNINYQTLMEWI GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 68->95|YOCH_BACSU|4e-04|46.4|28/100| TM:NTM 1 TM:REGION 24->45| RP:PDB:NREP 1 RP:PDB:REP 53->95|2djpA|1e-04|14.0|43/77| HM:PFM:NREP 2 HM:PFM:REP 73->95|PF01476|8.8e-06|34.8|23/44|LysM| HM:PFM:REP 2->72|PF02635|0.00096|35.1|57/119|DrsE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 43 STR:RPRED 44.8 SQ:SECSTR ####################################################ccccccccccccEEEEEEcccTTccHHHHHHHHTccHHHHHHH# DISOP:02AL 1-3| PSIPRED cHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHcccccEEEEEccccHHHHHHHHcccHHHHHHHc //